KEGG   Meriones unguiculatus (Mongolian gerbil): 110550667
Entry
110550667         CDS       T05884                                 

Gene name
Ugdh
Definition
(RefSeq) UDP-glucose 6-dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00520  Amino sugar and nucleotide sugar metabolism
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110550667 (Ugdh)
   00053 Ascorbate and aldarate metabolism
    110550667 (Ugdh)
   00520 Amino sugar and nucleotide sugar metabolism
    110550667 (Ugdh)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     110550667 (Ugdh)
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh 3HCDH_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 110550667
NCBI-ProteinID: XP_021496355
LinkDB
Position
Unknown
AA seq 493 aa
MVEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
HGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQKAVRALCAVYEHWVPKEKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSVDDQVSRLVTISKDPYEACDGAHALVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHTELQAIGFQIETIGKKVSSKRIPYTPGEIPK
FSLQDPPNKKPKV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggttgaaattaagaagatctgttgcattggtgcgggctatgttggtggacccacatgc
agtgtcattgctcatatgtgcccagaaatcagggtgacagttgttgatgtcaatgagtca
agaatcaatgcatggaattctccaacccttcctatttatgagcctggcctaaaagaagtg
gttgaatcttgtcgagggaaaaatctatttttttctaccaatattgatgatgccatcaga
gaagctgatttagtatttatttctgtaaacacaccaacaaaaacctatgggatggggaaa
ggccgggcagcagatttgaagtacatcgaagcttgtgctcgccgcattgtgcaaaactcg
catgggtacaagattgtgacggagaagagcacagtccccgtgcgcgcagcagagagcatc
cgccgcatatttgatgccaacacaaagcccaacttgaatttacaggtactgtccaatcct
gagttcttggcggagggaacagccatcaaggacctaaagaacccagacagagtcctgatt
ggaggggacgagacccccgagggccagaaagctgtccgggcgctctgtgctgtgtatgag
cactgggttcccaaggaaaagatcctcaccaccaacacttggtcctcagagctgtccaaa
ttggcagcaaatgcttttctagcgcaaaggatcagcagcattaactccataagcgctctg
tgtgaggcaacaggggctgatgtggaagaggtggcaacagctattggaatggaccaaaga
attggaaataagttcctgaaagccagtgtgggttttggtgggagctgcttccaaaaagat
gttctgaatttggtttatctttgtgaagctctgaatctgcccgaagtagctcgttactgg
cagcaggtcatagacatgaatgactaccagaggcggcggtttgcatcgcggatcatagac
agcctatttaatacagtgacggataagaagatagctatcctggggtttgcattcaaaaag
gatactggtgacaccagagagtcctccagcatctacatcagcaaatacctgatggatgaa
ggtgcacacctccatatatatgatccaaaagtgcccagggaacaaatagttgtggatctt
tcccatccaggtgtttcagtggatgaccaagtgtccagactggtgaccatttccaaggac
ccatatgaagcgtgtgacggcgcccatgctcttgtcatctgcactgagtgggacatgttt
aaggaactggattatgagcggattcataagaaaatgctgaagccagcctttatctttgat
gggaggcgcgtcctggacgggctgcacactgaactgcaggccattggcttccagattgaa
acaattggcaaaaaggtatcttccaagagaattccatatactcctggtgaaattccaaag
tttagtcttcaggatccacctaacaagaagcctaaagtctag

DBGET integrated database retrieval system