KEGG   Meriones unguiculatus (Mongolian gerbil): 110550982
Entry
110550982         CDS       T05884                                 

Gene name
Smo
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04360  Axon guidance
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110550982 (Smo)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110550982 (Smo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110550982 (Smo)
   05205 Proteoglycans in cancer
    110550982 (Smo)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110550982 (Smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mun04030]
    110550982 (Smo)
G protein-coupled receptors [BR:mun04030]
 Frizzled / Smoothened family
  110550982 (Smo)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 110550982
NCBI-ProteinID: XP_021496977
LinkDB
Position
Unknown
AA seq 778 aa
MAAVRPALLLPPLLLLLGAPGRGAAPGGNATAGGSARAAVPPTSPPALSRCGRAAPCEPL
RFNVCLGSALPYGATSTLLAGDSESQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPK
CENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCPNEVHNIRFNSSGQC
EAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHGYIAAFGAVTGLCTLFTLATFV
ADWRNSNRYPAVILFYVNACFFVGSLGWLAQFMDGARREIVCRADGTMRFGEPTSSETLS
CVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTV
AILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLLVGGYFLIRGVMTLFSIKSNH
PGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQAN
VTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLT
GQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSAD
VSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEQQASLWLVEAETSPEREKRLGRRK
KRRKRKKEVCPLGPAPELHHLSPGPGPAPSAVPRLPQLPQQKCLVAANAWGAGEPCRQGA
WTLVSSPFCPEPSPRQDAFLPGASAPRAWAQGRLQGLGSIHSRTNLMEAELLDADSDF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggccgccgtgcgccccgcgctgctgctgccgccgctgctgctgctgctgggggccccg
ggccggggggcggccccgggcgggaacgccacggccggcggcagcgcgcgggccgccgtg
ccgcccaccagcccgccggcgctgagccgctgcggccgcgccgccccctgcgagccgctg
cgcttcaacgtgtgcctgggctcggcgctgccctacggggccacgtccacgctgctggcc
ggggactcggagtcgcaggaggaggcgcacggcaagctcgtgctctggtcgggcctccgg
aacgccccccgctgctgggccgtgatccagcccctgctgtgcgctgtctacatgcccaag
tgtgagaatgaccgggtggagctgcccagccgcaccctgtgccaggccacgcgcggcccc
tgcgccatcgtggagcgggagcggggctggcctgacttcctgcgctgcacgccggaccgc
ttccccgaaggctgcccgaacgaggtgcacaacatccggttcaacagctcgggccagtgt
gaggcgccgctggtgcggacggacaaccccaagagctggtacgaggacgtggagggctgc
ggcatccagtgccagaacccgctcttcacggaggcggagcaccaggacatgcacggctac
atcgcggccttcggcgccgtcacgggcctctgcacgctcttcacgctggccaccttcgtg
gccgactggcggaactccaaccgctaccccgccgtcatcctcttctacgtcaacgcctgc
ttcttcgtgggcagcctgggctggctggcgcagttcatggacggcgcccgccgcgagatc
gtctgccgggcggacggcaccatgaggttcggggagcccacctccagcgagaccctgtcc
tgtgtcatcatcttcgtcatcgtgtactatgccctgatggccggcgtggtctggttcgtg
gtcctcacctacgcctggcacacctccttcaaggccctgggcaccacctaccagccgctc
tcgggcaagacgtcctacttccacctgctcacgtggtcgctgcccttcgtcctcaccgtg
gcgatcctcgctgtggcgcaggtggacggagactccgtgagcggcatctgcttcgtgggc
tacaagaactaccgctaccgtgccggcttcgtgctggctcccatcggcctggtgctcctc
gtggggggctacttcctcatccggggggtcatgacgctgttctccatcaagagcaaccac
cctgggcttctgagtgagaaggccgccagcaagatcaatgagacgatgctacgcctgggc
atttttggcttcctggcctttggctttgtgctcatcacctttagctgccacttctatgac
ttcttcaaccaggctgagtgggagaggagcttccgggactacgtgctatgccaggccaac
gtgaccatcgggctgcctaccaagaagcccattcctgactgcgagatcaagaaccggcct
agcctcctggtggagaagatcaacctatttgccatgtttggcacgggcattgccatgagc
acctgggtgtggaccaaggccaccctgctcatctggaggcggacctggtgcaggttgacg
gggcagagtgatgatgagccgaagcggatcaagaagagcaagatgatcgccaaggccttc
tctaagcggcgtgagctgctgcagaacccgggtcaggagctgtccttcagcatgcacacc
gtctcccacgatggacccgtggcgggtttggcttttgacctcaatgaaccatcagctgat
gtctcctcggcctgggcccagcacgtcaccaaaatggtagctcggagaggagccatactg
ccccaggacgtgtctgtcacgcctgtggcgactccggtgccaccggaacaacaagccagt
ctgtggctggttgaggcagagacctccccagagcgagagaagcgcttgggccggaggaag
aagcggaggaagaggaagaaggaggtgtgccccttggggcccgccccggagcttcaccac
ctcagccctggccccggccctgcccccagtgcggttccccggctgccccagctgccccag
cagaagtgcctggtcgccgccaacgcctggggagcgggggagccctgccgacagggagcc
tggacactcgtctccagccccttctgcccggagcccagtccccgacaagacgcttttctc
cctggtgcctcggccccgagggcctgggctcagggccgcctccagggcctggggtccatt
cattcccgcactaacctgatggaggctgagctcctggatgcagactcggacttctga

DBGET integrated database retrieval system