KEGG   Meriones unguiculatus (Mongolian gerbil): 110551008
Entry
110551008         CDS       T05884                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04012  ErbB signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04151  PI3K-Akt signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04934  Cushing syndrome
mun05162  Measles
mun05165  Human papillomavirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05206  MicroRNAs in cancer
mun05215  Prostate cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110551008 (Cdkn1b)
   04066 HIF-1 signaling pathway
    110551008 (Cdkn1b)
   04068 FoxO signaling pathway
    110551008 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    110551008 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110551008 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110551008 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    110551008 (Cdkn1b)
   05206 MicroRNAs in cancer
    110551008 (Cdkn1b)
   05203 Viral carcinogenesis
    110551008 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    110551008 (Cdkn1b)
   05220 Chronic myeloid leukemia
    110551008 (Cdkn1b)
   05215 Prostate cancer
    110551008 (Cdkn1b)
   05222 Small cell lung cancer
    110551008 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110551008 (Cdkn1b)
   04934 Cushing syndrome
    110551008 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    110551008 (Cdkn1b)
   05169 Epstein-Barr virus infection
    110551008 (Cdkn1b)
   05165 Human papillomavirus infection
    110551008 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110551008 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110551008
NCBI-ProteinID: XP_021497014
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFKNHKPLEGRYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRQAVPLIG
SQANSEDRRLVDQMPDPSDSPAGLAEQCPGMRKRPAADDSSSQNKRANRTEENVSDGSPN
AGTVEQTPKKPGLRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgagagtgtctaacgggagtccgagcctggagcggatggacgccagacaa
gcggagcaccccaagccttccgcctgcagaaacctcttcggcccggtcaatcacgaagag
ctcacccgggacttggagaagcactgccgagacatggaagaagcgagtcagcgcaagtgg
aacttcgactttaagaatcacaagcccctggagggcagatacgagtggcaggaggtggag
aagggcagcttgccggagttctactacagacccccgcgcccccccaagggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgccaggcggtgcctttaattggg
tctcaggcgaactccgaggaccggcgtttggtggaccaaatgcctgacccatcagacagc
ccggcggggttagcggagcagtgcccggggatgaggaagcgacctgcagcagatgattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttccccgaac
gctggcactgtggagcagacgcccaagaagcccggccttcgaagacaccagacgtaa

DBGET integrated database retrieval system