KEGG   Meriones unguiculatus (Mongolian gerbil): 110551033
Entry
110551033         CDS       T05884                                 

Definition
(RefSeq) immunity-related GTPase family M protein 1-like isoform X1
  KO
K14139  immunity-related GTPase family M protein [EC:3.6.5.-]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110551033
Enzymes [BR:mun01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     110551033
SSDB
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N AIG1 LYTB
Other DBs
NCBI-GeneID: 110551033
NCBI-ProteinID: XP_021497037
LinkDB
Position
Unknown
AA seq 434 aa
MKPSHKSYEESANKKNLLSQINLSASATSSYTQKCTNVDPLLPKMAEKRYPPLNSSFPFV
TSYQTDNSILPKASKNIEKALKGGKLLELAYEFKETVATLSQTPVNISVTGDSGNGISSF
INALRLIGHEEGDSAPTGVVRTTQTRAEYSSSHFPKVVLWDLPGLGATAQTVENYVKEMK
FRVCDLFIIVASEQFSSNHVKLAKVIQGMGKRFYIVWTKLDRDLSTSVLSELLLLQNIRE
NVGENLQKAGVNEPPIFLVSNLDPLLHDFPKLRETLYKDLSNIRCGEALTILYGTCEKIV
DDKMASWKERIANGNLKDSLGVRNDDDMGECLKAYRLVLGVDDDALQQVAQSMGTVVIAY
KANMKSQNLDTLRREDWKLRLMTYAVTDCLLTFLPCLRGCFRRMRHERMLLLVVQDTKAI
LKKILEDAIIPPQI
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaaaccatcacacaagtcctatgaggaatcagccaacaagaaaaatctactttcacaa
atcaacttgagtgcctctgctaccagcagttacacacagaaatgtacaaatgttgatccg
ctactccccaagatggccgagaagcgttatcctccactaaactcatccttcccctttgtc
acgtcatatcaaacagacaacagcattttacctaaggcgagcaagaacattgaaaaggcc
ttgaaaggagggaagctgctggaactggcatatgagttcaaggagactgtggcaacgttg
tcccaaacgccagtgaacatctctgtgactggggactcgggcaatggcatctcatctttc
atcaatgcactccgactcattggccatgaggaaggtgactcagctcccactggggtggtg
aggaccacccagactcgggctgaatactcttcatcccatttccccaaggtggtactgtgg
gacctgcctggcttgggagccacagcccaaaccgtagagaactatgtgaaagagatgaaa
ttcagagtctgtgacttattcatcattgtcgcctctgagcagttcagttcaaatcatgtg
aagctggccaaagtcatccaggggatgggaaagaggttctatattgtctggaccaagctg
gacagggacctcagcacaagcgtcctgtcggagctattgctcctgcagaacatcagggag
aatgtcggggagaatctccagaaggcgggggtgaacgagccccccatattcctggtatcc
aatctagaccctttgctacatgacttcccaaagcttagggaaacactttataaagacctc
tccaacatcaggtgcggtgaggccctaacgatcctttatggcacctgtgagaagatcgtt
gatgataaaatggcctcctggaaggagagaatagccaacgggaacctgaaggattctctt
ggtgtcagaaacgacgatgacatgggggagtgtctgaaagcctaccgactggtactgggt
gtagatgatgacgccctccagcaggtagcccagagtatggggacggtagtcatagcgtac
aaggccaacatgaagtcccagaacttggacactctccgcagagaggactggaaactgagg
ctgatgacgtatgcagtcacagactgcttgcttacgtttctcccatgcttgcgtggctgt
ttcaggcgcatgaggcatgaacgcatgcttctattagttgtccaagacaccaaggccatc
ctgaagaaaatcctggaagatgctatcatccctcctcaaatctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563362
Entry
110563362         CDS       T05884                                 

Definition
(RefSeq) immunity-related GTPase family M protein-like isoform X1
  KO
K14139  immunity-related GTPase family M protein [EC:3.6.5.-]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563362
Enzymes [BR:mun01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     110563362
SSDB
Motif
Pfam: IIGP Dynamin_N MMR_HSR1 FeoB_N RsgA_GTPase
Other DBs
NCBI-GeneID: 110563362
NCBI-ProteinID: XP_021516095
LinkDB
Position
Unknown
AA seq 397 aa
MPLCRVAPLPSNMEEADGSLKDKRLPCFSDAVLIHKDSNILSVEVIESMKAAVAGGKWEE
VASVVKELVQKTSRKTVKIAVTGDSGNGMSSFINAIRGIGHEEVDSAPTGVVRTTQVPAC
YSSSSFPNVELWDLPGTGATAQSIKDYMEEMQFNTYKLFIIVASEQFSSNHVKLAKAVQE
MEKRFYVVWTKLDRDLSMSALSEAQLLQSIRRNIQENLQKEQVKEPPIFLLSHMNPLSHD
FPELRETLQKDLFNIRKDGLLGTLFHIGKEAINERVKSIRSMDADNLCKDFGISNPDNVE
ESQKAFEKSFGVDDESLAMQFQDQQGGWPMTCWLHSGAQLLLTGVNKMLSKCFSGLSPTH
SQQRQRQVLDEVAKKTKNILWKILEDSTNRPLEGPDN
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgcctttgtgcagggttgctccattgccatccaacatggaagaggcagatgggtccctc
aaggataaacgattgccatgcttctccgatgctgtattgattcacaaagatagcaatatt
ttatctgtagaagtcatcgagagtatgaaggctgccgtggcaggagggaaatgggaggaa
gtagcctctgtggtcaaggagctcgtacagaagacatcaagaaaaacagtgaaaatcgct
gtgaccggggactctggcaatggcatgtcttccttcatcaatgccattagaggcattgga
catgaggaggtggattcagctcccaccggggtggtgaggaccacccaagtaccggcctgt
tattcctcctccagctttcccaacgtggagctgtgggacctgcccggcacaggggccaca
gcccagagcatcaaggactacatggaggagatgcagttcaacacctacaaacttttcatc
atcgtcgcgtctgagcagttcagctcgaatcacgtgaagctggccaaagctgtgcaggag
atggagaagaggttctacgttgtctggaccaagctggacagggacctcagcatgagtgcc
ctctctgaagcccagctactgcagagcatccgaaggaatatccaggagaatctccagaag
gagcaggtgaaggagccgcccatattcctgctctcccacatgaatcctttgtcacatgac
ttcccagagcttagggagacactacaaaaagacctcttcaacatcaggaaggatggcctc
ttaggaacccttttccatatcggtaaggaggctattaatgagagagtgaaatccattagg
agcatggatgcagacaatctatgcaaggattttggaatctccaatccagataatgtggaa
gagagtcagaaagccttcgaaaaaagctttggcgtggatgatgaatctcttgccatgcag
ttccaggatcaacaaggtggctggccaatgacttgctggcttcactctggagcccagctt
ttgcttacaggtgtaaacaagatgctctcaaaatgcttttctggcctttcacctacacac
agccaacagagacaaagacaagtgcttgatgaggttgctaagaaaaccaaaaacattctg
tggaaaatcctggaagactccactaaccgtcctctggaaggtccagacaactga

DBGET integrated database retrieval system