KEGG   Meriones unguiculatus (Mongolian gerbil): 110551603
Entry
110551603         CDS       T05884                                 

Gene name
Bad
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04140  Autophagy - animal
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04370  VEGF signaling pathway
mun04510  Focal adhesion
mun04722  Neurotrophin signaling pathway
mun04910  Insulin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun05010  Alzheimer disease
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05165  Human papillomavirus infection
mun05168  Herpes simplex virus 1 infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05223  Non-small cell lung cancer
mun05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110551603 (Bad)
   04014 Ras signaling pathway
    110551603 (Bad)
   04370 VEGF signaling pathway
    110551603 (Bad)
   04024 cAMP signaling pathway
    110551603 (Bad)
   04022 cGMP-PKG signaling pathway
    110551603 (Bad)
   04151 PI3K-Akt signaling pathway
    110551603 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110551603 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    110551603 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110551603 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110551603 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110551603 (Bad)
   04919 Thyroid hormone signaling pathway
    110551603 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110551603 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110551603 (Bad)
   05203 Viral carcinogenesis
    110551603 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110551603 (Bad)
   05212 Pancreatic cancer
    110551603 (Bad)
   05225 Hepatocellular carcinoma
    110551603 (Bad)
   05221 Acute myeloid leukemia
    110551603 (Bad)
   05220 Chronic myeloid leukemia
    110551603 (Bad)
   05218 Melanoma
    110551603 (Bad)
   05211 Renal cell carcinoma
    110551603 (Bad)
   05215 Prostate cancer
    110551603 (Bad)
   05213 Endometrial cancer
    110551603 (Bad)
   05223 Non-small cell lung cancer
    110551603 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110551603 (Bad)
   05014 Amyotrophic lateral sclerosis
    110551603 (Bad)
   05020 Prion disease
    110551603 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    110551603 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110551603 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110551603 (Bad)
   05161 Hepatitis B
    110551603 (Bad)
   05160 Hepatitis C
    110551603 (Bad)
   05162 Measles
    110551603 (Bad)
   05168 Herpes simplex virus 1 infection
    110551603 (Bad)
   05165 Human papillomavirus infection
    110551603 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110551603 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110551603 (Bad)
   01524 Platinum drug resistance
    110551603 (Bad)
   01522 Endocrine resistance
    110551603 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 110551603
NCBI-ProteinID: XP_021497963
LinkDB
Position
Unknown
AA seq 204 aa
MGTPKQPSLAPAHASGVRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDSSTT
DRGLGPSLTEDQPGPYLAPGLLGSVGHQQGRAVNSSHHGGAGAAETRSRHSSYPAGAAED
EGTEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
ASWTRIIQSWWDRNLGKGGSAPSQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagcagccctcgctggctcctgcacacgcctcaggcgtgaggaagtcg
gatcccggaatccggagcctagggagcgacgcgggaggaaggcggtggagaccagcagcc
cagagtatgttccagatcccagagtttgagccgagtgagcaggaagactccagcactaca
gataggggcctgggccctagcctcactgaggaccagccaggtccctacctggccccaggt
ctcctggggagcgtcggtcatcagcagggacgggcggtcaacagcagtcatcatggaggc
gctggagccgcggagacccggagtcgccacagttcatatcccgcgggggccgcggaggat
gaagggacggaggaggagctcagcccctttcggggccgctcgcgttcggctccccccaat
ctctgggctgcgcagcgctatggacgcgagctccgaaggatgagcgatgagtttgagggt
tctttcaagggacttcctcgcccaaagagcgcaggcactgcaacgcagatgcgacaaagc
gccagctggacgcgcattatccaatcctggtgggatcgaaatttgggcaaaggaggctcc
gccccctcccagtga

DBGET integrated database retrieval system