KEGG   Meriones unguiculatus (Mongolian gerbil): 110551705
Entry
110551705         CDS       T05884                                 

Gene name
Pik3r5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04022  cGMP-PKG signaling pathway
mun04062  Chemokine signaling pathway
mun04072  Phospholipase D signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04371  Apelin signaling pathway
mun04611  Platelet activation
mun04725  Cholinergic synapse
mun04921  Oxytocin signaling pathway
mun05145  Toxoplasmosis
mun05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110551705 (Pik3r5)
   04072 Phospholipase D signaling pathway
    110551705 (Pik3r5)
   04022 cGMP-PKG signaling pathway
    110551705 (Pik3r5)
   04151 PI3K-Akt signaling pathway
    110551705 (Pik3r5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110551705 (Pik3r5)
   04062 Chemokine signaling pathway
    110551705 (Pik3r5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110551705 (Pik3r5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110551705 (Pik3r5)
  09156 Nervous system
   04725 Cholinergic synapse
    110551705 (Pik3r5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110551705 (Pik3r5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110551705 (Pik3r5)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110551705 (Pik3r5)
SSDB
Motif
Pfam: PI3K_1B_p101 DUF2284 BUD22
Other DBs
NCBI-GeneID: 110551705
NCBI-ProteinID: XP_021498145
LinkDB
Position
Unknown
AA seq 877 aa
MQPAATTCTEDRIHHALERCLHGLSLGRRAAPWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYC
SICRELLTFIDAELKAPGISYQRLVRAEQGLSIKSHRSSTVTVLLLNPVEVQAEFLAVAD
KLSTPGQSPHGAYVTLLLHAFQATFGARCDLPRLHRKLQSKTLEELEDIFTETAEAQELA
AGIGDVAEARQWLRAKLQAVGEKAGFPGILDTANPGKLHTIPIPVARCYTYSWNQDSFDI
LQEILLKEQELLPPGILGDDEEEEEEEEEEEDLEIDRHSAERDSLLSTSSLGSHDSTLLL
TTSHASGPTLSRQVLTTFVSGLSDGMDSGYVEDSEESSPEWTKKPGGQQRQGQRRPGQKF
NRFYKLLKSTSQLVLRRDSRSLEGSADAALPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQ
PRLSTQLPSWLLAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRL
ENSHPILTRFFKLQFFYVPVKRSHGASSSACPPSLSQSSAYPTDSLRHPTLAELGVAPCE
DSTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEARPLGGPAAQLPILADMLLY
YCRFAARPVLLQVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGPGSKRLGIDDD
REAVPLTLQIIYSKGAVSGRSRWSSLEKICTSANLSKACQKPEELDSSMEALTLTLTEVV
KRQNPKSKKGFNQISTSHIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYKP
EKSSLPPQRSCGQPEEAGTDLCSLLCLPIMTFSGALP
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgcagccagcagccacgacatgcacggaggaccgcatccaccatgctctggagcgttgc
ttgcatggactgagcctcggacgacgtgctgccccctggtcagccgggctgtgcctgaac
tgctggagcctacaggagctggtcagcagggacccgggccacttcctcatcctcctggaa
cagatcctacagaaaacccgagaggtccaagaaaagggcacctatgacctcctcgcccca
ctggctctgctcttctattccaccgtcctctgtacgccacacttcccaccggactccgac
ctcctcctgaaggcagccagcacctaccactgcttcctgacgtggcccgttccctactgc
agcatctgccgagagctgctcaccttcattgacgctgaactcaaggccccggggatctcc
taccagcgtctggtgagggctgagcagggcctgtccatcaagagccaccggagttccact
gtcaccgtgctgttgctgaaccctgtggaggtccaggccgaattcctggctgtggcggac
aagctgagtacaccaggacagtcaccccacggcgcctacgtcaccctgctcctgcacgcc
ttccaggccacctttggggcccgctgtgaccttcccaggctgcaccgcaagcttcagtcc
aagacgctggaagagcttgaagacatcttcacagagactgcggaggcccaggagctggca
gctggcattggggatgtagcagaggcccgccagtggctgcgggccaagctgcaggcagtg
ggagagaaagccggcttccctggcatcttagacactgcaaaccctggaaaactccacacc
atccccatccctgtcgccaggtgctatacctacagctggaaccaggacagcttcgacatc
ctgcaggaaatcctccttaaggagcaggagctgctgccaccagggattctgggagacgat
gaagaggaggaggaggaggaggaagaagaggaggacttagagattgacaggcacagtgcc
gagagggactcgctcctctccaccagctctctggggtctcatgactccactctgttgctc
accacctctcatgcctcggggcccacgctgtcccgccaggtcctgaccacctttgtctca
ggcctctcggatggcatggacagtggctatgtggaggacagcgaggagagctccccggag
tggaccaagaagcccggcggccagcagcgccaggggcagcgcaggcctgggcagaagttc
aacaggttctacaaactgttgaagagcaccagccagctggtcctgcggagagactctcgg
agcctggagggcagcgccgatgcagccctgcctctgcggcgggccgggagcctctgcagc
cccctggactgcccagcccagctcccctccagggcccagcgctcacgctccctaccccag
cccaggctcagcacccagctacccagctggcttctggcacccccctcacaccaccagcgt
cgccgccccttcctcagcggcgatgaggaccccaaggcttccactctccgggttgtggtc
tttggctccgaccggatttcgggaaaggtggcccgggcatatagcaagctcaggaggctg
gagaacagccacccgatcctcacacgcttcttcaagcttcagttcttctacgtgcccgtc
aagcgaagccacggagccagctccagtgcctgcccgccctctctgagccagtcatctgca
taccccacagattccctgaggcaccccaccctggcagagcttggtgtggccccatgcgag
gacagtaccaatgacatttctcactacctcggcatgctcgacccctggtatgaacgcaat
gtgctgggcctcatgcatctgcctcctgaggtcctttgccagcagtccctgaaggcagaa
gctcggcccctggggggcccggccgcccagctgcctatcctggccgacatgttgctgtac
tactgccgctttgccgcccgcccggtgttgctgcaggtctatcagacagagctgaccttc
gtcactggggagaagactacggagatcttcattcagtctctggagctgggtcactctgca
accacgcgtgctatcaaggcttcaggtccgggcagcaagcggctgggcattgatgacgac
cgagaggccgttcctctaacactacagattatttacagcaagggagccgtcagtgggcga
agccgctggagcagcctggagaagatctgcacgtctgccaacctcagcaaggcctgccag
aagccggaggagctggactccagcatggaggcgctgacgctaaccttgacggaagtggtg
aaaaggcagaaccctaagtccaagaagggctttaaccagatcagcacctcccacatcaaa
gtggacaaggtacagatcatcggctccagcagctgcccctttgccgtgtgtctagaccag
gatgagagaaagatcctgcagagcgtggtcaggtgtgaagtgtccccctgctacaagcca
gagaagagcagcctgccaccccagaggtcctgcggccagccggaagaggctgggactgac
ctgtgctcccttctctgccttcccatcatgactttcagtggagctctgccctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110551706
Entry
110551706         CDS       T05884                                 

Gene name
Pik3r6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04022  cGMP-PKG signaling pathway
mun04062  Chemokine signaling pathway
mun04072  Phospholipase D signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04371  Apelin signaling pathway
mun04611  Platelet activation
mun04725  Cholinergic synapse
mun04921  Oxytocin signaling pathway
mun05145  Toxoplasmosis
mun05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110551706 (Pik3r6)
   04072 Phospholipase D signaling pathway
    110551706 (Pik3r6)
   04022 cGMP-PKG signaling pathway
    110551706 (Pik3r6)
   04151 PI3K-Akt signaling pathway
    110551706 (Pik3r6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110551706 (Pik3r6)
   04062 Chemokine signaling pathway
    110551706 (Pik3r6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110551706 (Pik3r6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110551706 (Pik3r6)
  09156 Nervous system
   04725 Cholinergic synapse
    110551706 (Pik3r6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110551706 (Pik3r6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110551706 (Pik3r6)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110551706 (Pik3r6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 110551706
NCBI-ProteinID: XP_021498153
LinkDB
Position
Unknown
AA seq 768 aa
MESSDVELDFQRSVQAVLRELNTPNPALQSTPGMWRWSLHKKVERNPGKSSVLVRILLRE
LEKAESEDAKHVIIPLLLTLMYVLTKATGITEDLYHRAYTFCTRLLTLPAPYSTVALDCA
IRLKIETAVPGTLYQRTVIAEQNLTSELYPYQDRVLLFVDPELVSASVCSALLLEIEAAQ
EQQSPEACMRHVVSHALKAALGEACHTGALTRKLQASSRRALEHYFHAVVAAVEQVASED
SPSRLAHLERLEEIYCSLLGSAATRRRCVGDLLQDRLPGIPLPSPSITFHLWSDPEQLWK
ELVLFLRPRSQLRLSSDLEALDLQGLGLDRDLARVSTDSGIERDLPFGSDELPAPSSPEM
EPAALQRKGGIRKRVWPPDFSVPGSWDGPPGLHRRTGRPSGDGELLPGVSRVHTARVLVL
GDDRVLGRLAQAYYRLRKRESKNFCLAPRLSLQLYYIPVLLPQDPEASRKAELGEMASFL
GRADPWYESTVNTLCPAILKLAEMPPCLDTSRTVDPFILDVITYYVRMGNQPIYFQLYKV
KIFTNLSRDPIEDVFLTELKVKIQDSKSPKEGSSPRRRGAAEGLGAELSLCYQKALLSHR
PREVTVSLRTTGLVLKAIPAGDTEGPRSPSFPLTRLPAHSASGLSQCTVPNAASAPGCSR
LRVSVTEVVKSSNLAGRSLTTATNTFWTSSIQVQSQDQRLLTLWLDKDGGRTFRDVVRFE
AGPCPEPCSRAQKSKMAGLNSHGQETEKSMVKPNSLLMPINTFSGIIQ
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggagagttcagatgtggagctggacttccagaggagcgtgcaggccgtgctgcgagag
ctcaacaccccgaacccagccctccagagtactccgggcatgtggagatggtctctgcac
aagaaggtggagagaaacccaggaaagagctcggtgctggtccgaattctgctcagagag
ctggagaaggcggagagcgaggacgccaagcacgtcatcatccccctgctgctcactcta
atgtacgtgctcactaaggccacaggcatcacggaagacctctaccacagagcttatacc
ttctgcaccaggctcctgaccctgcctgccccctactccacagtggccttggactgtgcc
ataaggctgaaaatagagacggccgtcccaggtacactgtaccagaggaccgtcatcgcc
gagcagaacctgacaagtgagctgtacccttaccaggacagagtgttgctgtttgtggac
cctgagctggtctctgcctccgtgtgcagcgccctgctgctggagatcgaggcggcccag
gagcagcagagccccgaggcctgcatgcgccacgtggtctcccacgccctgaaggccgct
ctgggggaagcctgccacacaggcgctctcaccaggaagctgcaggccagctcccgccgc
gccctggagcactatttccacgccgtcgtggctgccgtagagcaggtggctagcgaggac
agccccagccggctggcacacctggagaggctggaggagatttactgctcgctgctcggg
tcggcggccaccagacggcgctgcgtgggagaccttctccaagaccgactgccaggcatc
cccctgcccagcccctccatcaccttccacctgtggagcgacccggagcagctctggaag
gaactggtgctctttcttcgcccacgctcccagctgcgcctcagttctgacctggaggcc
ttggacctacaaggcctggggctggaccgggacctggccagggtgtccaccgacagcggt
attgagcgggacctccccttcgggagtgacgagctcccggcgcccagcagccccgagatg
gagccggctgcactgcagcgcaaggggggcatccggaagcgcgtgtggccccccgacttc
tccgtgcctggcagctgggacgggcccccggggctgcatcggaggaccggccggcccagc
ggggacggggagctgctgcctggggtctccagggtgcatacggcgcgcgtgctggtgctg
ggagatgacagggtgctggggcgcttggcccaggcttactacagactcaggaaacgggaa
agcaagaacttctgcctggctcctaggctcagcctgcagctctactacataccagtgctg
ctgcctcaggatccagaagcatccaggaaggcagagctgggagagatggcttccttcctg
ggtcgggcagacccgtggtacgaaagcaccgtcaacacgctgtgccccgccatcctcaag
ctggctgagatgcctccctgcctggacacatcccggaccgtggacccctttatcctggat
gtcatcacgtactatgtccgtatgggcaaccaacccatctacttccagctctacaaggtg
aagatcttcaccaacctgagtcgtgaccctatagaggatgtttttctcaccgagctgaaa
gtgaagatccaagactccaagtcccccaaagagggctcttcaccccgcaggagaggggca
gccgagggcctcggagctgagctgtctttgtgctaccagaaggccctgctcagccacagg
ccccgagaggtcactgtttctctgcggaccaccggcttggtgctgaaggccattccagct
ggtgacactgaaggacccagaagccccagcttcccactcacgcgtctccccgctcactcg
gcttcagggctctcccagtgcacggtgcccaacgccgcctccgctccgggctgctcgcgc
ctgcgcgtcagcgtgacggaggtcgtcaagtcctccaatctggcaggaaggtcgctcacg
acagcaacaaacaccttctggacatccagtatccaagtccagagccaagaccagaggctg
ctcacgctgtggctggacaaggatggcgggcgcaccttcagagatgtggtcagatttgag
gctggtccctgcccagagccatgttcacgggcccagaaatccaaaatggcgggcctcaat
tcacatgggcaggagacagaaaagagcatggtcaagcccaattctctcctgatgcccatc
aacacgttctctggcatcatccaatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110565083
Entry
110565083         CDS       T05884                                 

Gene name
Pik3cg
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00562  Inositol phosphate metabolism
mun01100  Metabolic pathways
mun04022  cGMP-PKG signaling pathway
mun04062  Chemokine signaling pathway
mun04072  Phospholipase D signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04371  Apelin signaling pathway
mun04611  Platelet activation
mun04725  Cholinergic synapse
mun04921  Oxytocin signaling pathway
mun05132  Salmonella infection
mun05145  Toxoplasmosis
mun05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110565083 (Pik3cg)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110565083 (Pik3cg)
   04072 Phospholipase D signaling pathway
    110565083 (Pik3cg)
   04022 cGMP-PKG signaling pathway
    110565083 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    110565083 (Pik3cg)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110565083 (Pik3cg)
   04062 Chemokine signaling pathway
    110565083 (Pik3cg)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110565083 (Pik3cg)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110565083 (Pik3cg)
  09156 Nervous system
   04725 Cholinergic synapse
    110565083 (Pik3cg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110565083 (Pik3cg)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110565083 (Pik3cg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110565083 (Pik3cg)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110565083 (Pik3cg)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110565083 (Pik3cg)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 110565083
NCBI-ProteinID: XP_021518339
LinkDB
Position
Unknown
AA seq 1102 aa
MELESYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDHFLLLYQKKGQWYEIYDRYQVVQTLD
CLHYWKMMHKSPGQIHVVQRHAPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRL
VTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFIVIHRGTTSQTVKVSADDT
PGTILQSFFTKMAKKKSLMNIPESQGEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNG
DEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFGIKI
KDLPRGALLNLQIYCCKTPAQSNKASAESPGSESKGKAQLLYYVNLLLIDHRFLLRHGDY
VLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRALRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLQDFTQQVQVIEMFQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSYLP
KSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTVLSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKSSPHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagagctatgagcaacccgtggttctgagagaggacaaccttcgccggcgc
cggaggatgaagccgcgcagcgcggcaggcagcctgtcttccatggagctcatccccatc
gagtttgtcctgcccaccagccagcgcatcagcaagacgccggaaacggcgttgctgcac
gtggccggccatggcaacgtggagcagatgaaagctcaggtgtggctgcgcgcgctggaa
accagcgtggctgccgagttctaccaccgcctgggcccggaccacttcctcctgctctac
cagaagaagggacagtggtatgagatctacgacaggtatcaggtggtgcagaccctagac
tgcctgcactactggaagatgatgcacaagagccccggccagatccacgtggtacagcga
cacgccccttccgaggagacccttgctttccagaagcagctcacctccctgatcggctac
gacgtcaccgacatcagcaatgttcatgacgacgagctggagttcactcgccgccgtctg
gtcacgccccgcatggctgaggtggctggccgggatgccaaactctatgccatgcaccct
tgggtgacgtccaaacctctccctgactacctgtcaaaaaagatcgccaacaactgcatc
ttcatcgtcatccaccgcggtaccaccagtcaaaccgtcaaggtctcggcagatgatact
ccggggaccattctccagagcttcttcaccaagatggccaagaagaagtccctaatgaat
atcccagagagtcagggagagcaggactttgtgctgcgggtctgcggccgcgatgagtac
ctggtgggcgaaacgcccctcaaaaacttccagtgggtgaggcagtgcctcaagaacgga
gatgagatccacctggtgctcgacacgcctccggacccagccctggacgaggtgaggaag
gaagaatggccgctcgtggacgactgcactggcgtcaccggctaccacgagcagctgacc
atccacggcaaggaccacgagagcgtgttcacggtgtctctgtgggactgtgaccggaag
ttcagggtcaagatcagaggcatcgatatccctgtcctgcctcggaacaccgacctcact
gttttcgtggaagcaaacatccagcatggccagcaagtcctttgtcagcggagaaccagc
ccgaagcccttcacggaagaagtactctggaatgtgtggctggagttcggcatcaaaatc
aaagacttgcccagaggggccctgctgaacctccagatctactgctgcaaaactccagcc
cagtccaacaaggcttctgccgagtcgccaggctccgagtccaagggcaaagcccagctt
ctctattacgtgaacttgctgttaatagaccaccggttcctcctccgccacggggactat
gtgctccacatgtggcagatatccgggaaggcggaagagcagggcagcttcaacgccgac
aagctcacatctgcaaccaatcctgacaaggagaactccatgtccatctccatcctgctg
gacaactactgtcacccgatagccctgcctaagcatcagcccacccctgacccagaagga
gatagggttcgagcagaaatgcccaatcagcttcgaaagcaattggaggcgatcatagcc
acggacccacttaaccccctcacggcagaggacaaagaattgctctggcattttagatat
gaaagcctgaagcatccgaaggcataccctaagctgttcagctcggtgaaatggggacag
caagaaattgttgccaaaacgtaccagctgttagccagaagggagatctgggatcaaagt
gctttggacgttggtttaaccatgcagctcctggactgcaatttttcagatgaaaacgtg
agagccattgcagttcagaaactggagagcttggaggatgatgacgtcctacattacctg
ctccagctggtgcaggctgtgaaattcgaaccataccatgacagtgcgctggccaggttc
ctactgaagcgtgccttaagaaacaaaaggattggccacttcttgttctggttcttgcgg
agtgagatagcccagtcccgacactatcagcagaggttcgcggtgatcttggaggcatac
ctgaggggctgcggcacagccatgctgcaggacttcacgcagcaggtccaagtgatcgag
atgttccaaaaagtcaccctggatatcaagtcgctctctgcagagaagtatgacgtcagt
tcccaagtcatttcacagcttaagcaaaagcttgaaaacctgcagaattcgtatctcccc
aagagctttagagttccctatgatcctggactgaaagcaggtaccctggtgatcgaaaag
tgtaaagtgatggcctccaagaagaagccgctgtggcttgagttcaagtgtgccgacccc
acagtcctatctaatgagaccattgggatcatctttaaacacggcgacgatctgcgccaa
gacatgctgatcttacagatcctacgcatcatggagtccatttgggagacagaatctctg
gacctgtgcctcctgccatatgggtgcatctcaactggtgacaaaataggaatgatcgag
attgtgaaggacgccacaacaatcgctcagattcagcaaagcacagtgggtaacaccggg
gcgttcaaggatgaagtcctgaatcactggctcaaggaaaaatgccctattgaagaaaaa
tttcaggcggcagtggagaggtttgtctactcctgtgcaggctactgtgtggccacgttc
gttcttgggataggtgacaggcacaacgacaacattatgatctcagagacaggaaatcta
tttcatatagactttggacacattcttgggaattacaagagcttcctgggcattaataaa
gagagagtgccatttgtcctaaccccggacttcttgtttgtgatgggaacgtctggaaaa
aagtcaagcccacacttccagaaatttcaggatgtctgtgtcaaggcttacctagctctg
cgccaccacacaaaccttctgatcatcctgttctccatgatgctgatgacagggatgccc
cagctgaccagcaaagaagacattgagtatatccgggatgccctcacagtggggaagaac
gaggaggatgctaagaaatatttccttgatcagattgaagtctgcagggacaaaggatgg
accgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagagaaacac
tccgcttaa

DBGET integrated database retrieval system