KEGG   Meriones unguiculatus (Mongolian gerbil): 110552462
Entry
110552462         CDS       T05884                                 

Gene name
Ldlr
Definition
(RefSeq) low-density lipoprotein receptor isoform X1
  KO
K12473  low-density lipoprotein receptor
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04144  Endocytosis
mun04913  Ovarian steroidogenesis
mun04925  Aldosterone synthesis and secretion
mun04927  Cortisol synthesis and secretion
mun04934  Cushing syndrome
mun04976  Bile secretion
mun04979  Cholesterol metabolism
mun05145  Toxoplasmosis
mun05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110552462 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110552462 (Ldlr)
   04925 Aldosterone synthesis and secretion
    110552462 (Ldlr)
   04927 Cortisol synthesis and secretion
    110552462 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    110552462 (Ldlr)
   04979 Cholesterol metabolism
    110552462 (Ldlr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110552462 (Ldlr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110552462 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110552462 (Ldlr)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110552462 (Ldlr)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF SGL EGF_CA EGF hEGF TMEM154
Other DBs
NCBI-GeneID: 110552462
NCBI-ProteinID: XP_021499471
LinkDB
Position
Unknown
AA seq 863 aa
MRTAWAVALLLAAAAGLSEDSCTKNEFQCRDGKCIASKWVCDGLAECPDGSDEAPETCMS
VTCQSKEFSCGGRVSRCIPNSWRCDGRADCENGSDEQGCAPKTCSQDEFRCQDGRCISQQ
FVCDQDRDCLDGSDEAHCEITTCGPAHFRCNASACIPSLWACDGDADCEDGSDEWPQNCG
GRDTSSLWTSDPCSSLEFHCGSGECIHRSWVCDGGADCKDKSDEEHCVAPTCRPDEFQCA
DGTCIHGSRQCNQEHDCQDMSDELGCVNMTRCDGPNKFKCHSGECITWDRVCDSSRDCQD
WSDEPIKECKTNECLDGNGGCSHICKDLKIGYECLCPGGFRLADQHKCEDIDECQEPDTC
SQLCVNLEGSYKCECRPGFHMDPHTRVCKAVGSIAYLLFTNRHEVRKMTLDRSEYTSLIP
NLKNVVALDTEVANNRIYWSDLSQRKIYSALLDQAPSLPHDTIISVDLQAPDGLAVDWIH
GNIYWTDSVPGSVSVADTKGVRRKTLFQEKGSRPRAIVVDPVHGFMYWTDWGTPAKIKKG
GLNGVDIYSLVTENIQWPNGITLDLPSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKQL
AHPFSLAIYEDKVFWTDIINEAIFSANRLTGSDVHLVAENLLSPEDIVLFHNITQPRGVN
WCERTALPNGGCQYLCLPAPQINPHSPKFTCACPDGMLLAEDMRTCRTEVTPVPTTQGTS
ATRPVVTVTAARPTKHEDQSASSTSGQPGHIPGLSTVEPVTVSQQVQGDMAGRGNEEQPQ
GVGVLSVILPIALVILLVVGAILLWRNWRLRNINSINFDNPVYQKTTEDELHICRSQDGY
TYPSVSVAFRGREETSDKVKDSS
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgcgcaccgcgtgggccgtcgccctgctcctggccgccgccgccggcctctcagaagac
tcatgcaccaagaacgaattccagtgcagggacgggaagtgcatcgccagcaagtgggtc
tgcgacggcctcgccgagtgcccggacggctctgacgaggccccggagacatgcatgtct
gtcacctgtcagtccaaggagttcagctgtgggggccgcgtcagccggtgcattccgaac
tcctggagatgtgacggacgggccgactgtgagaatggctcggacgaacaaggctgcgcc
cccaagacgtgctcccaggatgaattccgctgccaggacggcaggtgcatctcccagcag
ttcgtgtgtgaccaggaccgcgactgcctggacggctcggacgaggcccactgcgagatc
accacctgcggccccgcccacttccgctgtaacgcctccgcctgcatccccagcctgtgg
gcctgcgacggggatgcggactgtgaggacggctccgatgagtggccacagaactgcggg
ggccgagacacctcctccctgtggaccagcgacccctgctcctccctggagttccactgt
ggcagtggcgagtgcatccaccgcagctgggtctgcgacggcggcgccgactgcaaggac
aagtccgacgaggagcactgcgtggcgcccacgtgccggcctgacgaattccagtgtgca
gatggcacctgcattcacggcagccgccagtgcaaccaagaacacgactgccaggacatg
agtgacgagctcggctgcgtcaacatgacacggtgcgatgggcccaacaagttcaagtgc
cacagtggcgaatgcatcacctgggacagagtgtgcgacagcagccgggactgtcaggac
tggtcggatgagcccatcaaggagtgcaagaccaacgagtgcttagacggcaatggtggc
tgctcccacatctgcaaggacctcaagattggctatgagtgcttgtgtcccggcggcttc
cggctggcggaccagcacaagtgtgaagatatcgacgagtgccaggagccggacacctgc
agccagctctgtgtgaacctggaaggcagctacaagtgcgagtgccggcctggtttccac
atggaccctcacaccagggtctgcaaggctgtgggctccatagcatatctgctcttcact
aaccgccacgaggtaaggaagatgaccctggaccggagtgagtacaccagcctaatcccc
aacctgaagaacgtggtggccctggacaccgaggtggccaacaatagaatctactggtct
gacctgtcccagagaaagatctacagcgccctgctggaccaagcccctagcttgccccac
gacaccatcatcagcgtggacctgcaggctccggatgggctggcggtggactggatccat
ggcaacatctactggacggactccgtcccgggcagcgtctctgtggccgacacgaagggt
gtgaggaggaagacgctgttccaagagaaagggtccaggcccagagccattgtggtggac
cctgtgcatggcttcatgtactggacagactggggcacacctgccaagatcaagaaaggg
ggcttgaacggtgtggacatctactctctggtgacagagaacatccaatggccgaatggc
atcacactagaccttcccagtggccgcctctattgggttgattccaaactccactctatc
tccagcattgatgtcaatgggggcaatcggaagaccattttggaggatgagaagcagctg
gcccaccccttctccttggccatctatgaggataaagtgttctggacggatatcatcaat
gaagccattttcagtgccaatcgcctcacgggttcagatgttcatttggtggctgaaaac
ctcttgtccccagaggatattgtcctgttccacaacatcacgcagcccagaggagtgaac
tggtgtgagagaacagccctccccaatggtggctgccagtacctgtgcctgccggccccc
cagatcaacccccactcccccaaattcacctgtgcctgccccgatggcatgctgctagcg
gaggacatgaggacctgccgcacagaagtcactcctgtgccgaccacccaggggacatcc
gccaccaggccggtggtcaccgtaacagctgccaggcccacgaagcacgaggaccagtcg
gcttccagcacttctgggcagcctgggcacatcccagggctcagcactgtggagccggtg
acagtgtcgcagcaagtccagggcgacatggctggcagagggaatgaggagcagccgcag
ggcgtgggggtcttgtctgtcatcctccctattgcgctggtcattctcctcgtcgtcggg
gccatcctgctgtggaggaactggcggctgaggaacatcaacagcataaactttgacaac
ccagtgtaccagaagaccacggaggacgagctccacatctgccgtagccaggacggctat
acctacccctcagtgagtgtggcctttcgtggaagagaggagacatcagacaaagtgaag
gatagcagttag

DBGET integrated database retrieval system