KEGG   Meriones unguiculatus (Mongolian gerbil): 110552558
Entry
110552558         CDS       T05884                                 

Gene name
Nfkbib
Definition
(RefSeq) NF-kappa-B inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04062  Chemokine signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04722  Neurotrophin signaling pathway
mun04920  Adipocytokine signaling pathway
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05162  Measles
mun05164  Influenza A
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110552558 (Nfkbib)
   04622 RIG-I-like receptor signaling pathway
    110552558 (Nfkbib)
   04623 Cytosolic DNA-sensing pathway
    110552558 (Nfkbib)
   04660 T cell receptor signaling pathway
    110552558 (Nfkbib)
   04658 Th1 and Th2 cell differentiation
    110552558 (Nfkbib)
   04659 Th17 cell differentiation
    110552558 (Nfkbib)
   04662 B cell receptor signaling pathway
    110552558 (Nfkbib)
   04062 Chemokine signaling pathway
    110552558 (Nfkbib)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110552558 (Nfkbib)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110552558 (Nfkbib)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110552558 (Nfkbib)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110552558 (Nfkbib)
   05164 Influenza A
    110552558 (Nfkbib)
   05162 Measles
    110552558 (Nfkbib)
   05169 Epstein-Barr virus infection
    110552558 (Nfkbib)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110552558 (Nfkbib)
   05140 Leishmaniasis
    110552558 (Nfkbib)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110552558 (Nfkbib)
Transcription factors [BR:mun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    110552558 (Nfkbib)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 110552558
NCBI-ProteinID: XP_021499656
LinkDB
Position
Unknown
AA seq 361 aa
MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDT
ALHLAVIHRHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGA
LVAERGGHTALHLACRVRAHACASVLLQPRPRGPRDASDNYLTQSQDRHPDTSHTPVAVS
PQPNPENEEEASDDDWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTC
GRTPLHLAVEAQSAPVLELLLRAGADPATRMYGGRTPLGSALLRPNPILARLLRAHGAPE
PEDEDDKLGPCSSSSSSSDSDSDSRDEGDEYDDIVVHRGRSQKRLPPSPASRPPPDDSNP
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggccggggtcgcgtgcttgggaaaaactgcggacgccgatgaatggtgcgacagcggc
ctgggatctctaggtcccgacgcagcggctccaggaggaccaggtctgggcgcagagttg
ggcccggagctgtcgtgggcgcccctggtctttggctacgtcactgaggatggggacacg
gccctgcacttggccgtgatacatcggcatgagcccttcctggatttcctcctgggcttc
tccgccggcactgagtacctggacctgcagaatgacctaggccaaacggccctgcaccta
gcagccatcctgggggaggcgtccacggtagagaagctgtatgcagctggcgcgggagcg
ttggtggctgagagagggggccacaccgcactacacttggcctgccgggtgagggcacac
gcgtgcgcatccgtgctgctccagccccgccccagaggcccacgggatgcctccgataac
tacctcactcagagccaggatcgtcacccagacaccagccacacccctgttgctgtgagc
ccccagcccaacccagagaacgaggaggaggcgagcgatgacgactggaagctgcagctg
gaggctgagaactatgagggccacactccactccatgtagctgtcatccacaaagatgca
gagatggtccggctgctcagggatgccggggctgacctcaataagccggagcccacttgc
ggccggacccccctgcacctggcggtagaagcccagtcggcccccgtgctggagcttctc
ctgagagctggtgccgaccccgccacccgcatgtatgggggccgcaccccacttggcagt
gccctgctccggcccaaccccatccttgcccgcctcctccgtgctcacggagcccctgaa
cctgaggatgaggatgacaagcttggcccttgcagcagcagcagcagcagcagcgacagc
gacagtgacagcagagatgagggcgatgaatatgatgacattgtggtccacaggggcagg
agccagaagcggctcccgccctccccggcatccagaccccctcccgatgactccaaccct
gcctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110562401
Entry
110562401         CDS       T05884                                 

Gene name
Nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha isoform X1
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04064  NF-kappa B signaling pathway
mun04210  Apoptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04920  Adipocytokine signaling pathway
mun04926  Relaxin signaling pathway
mun04931  Insulin resistance
mun05132  Salmonella infection
mun05134  Legionellosis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05215  Prostate cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110562401 (Nfkbia)
   04668 TNF signaling pathway
    110562401 (Nfkbia)
   04024 cAMP signaling pathway
    110562401 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110562401 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110562401 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    110562401 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    110562401 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    110562401 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    110562401 (Nfkbia)
   04660 T cell receptor signaling pathway
    110562401 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    110562401 (Nfkbia)
   04659 Th17 cell differentiation
    110562401 (Nfkbia)
   04657 IL-17 signaling pathway
    110562401 (Nfkbia)
   04662 B cell receptor signaling pathway
    110562401 (Nfkbia)
   04062 Chemokine signaling pathway
    110562401 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110562401 (Nfkbia)
   04926 Relaxin signaling pathway
    110562401 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110562401 (Nfkbia)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110562401 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110562401 (Nfkbia)
   05203 Viral carcinogenesis
    110562401 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110562401 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110562401 (Nfkbia)
   05215 Prostate cancer
    110562401 (Nfkbia)
   05222 Small cell lung cancer
    110562401 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110562401 (Nfkbia)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110562401 (Nfkbia)
   05135 Yersinia infection
    110562401 (Nfkbia)
   05134 Legionellosis
    110562401 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110562401 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    110562401 (Nfkbia)
   05161 Hepatitis B
    110562401 (Nfkbia)
   05160 Hepatitis C
    110562401 (Nfkbia)
   05171 Coronavirus disease - COVID-19
    110562401 (Nfkbia)
   05164 Influenza A
    110562401 (Nfkbia)
   05162 Measles
    110562401 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    110562401 (Nfkbia)
   05163 Human cytomegalovirus infection
    110562401 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110562401 (Nfkbia)
   05169 Epstein-Barr virus infection
    110562401 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110562401 (Nfkbia)
   05140 Leishmaniasis
    110562401 (Nfkbia)
   05142 Chagas disease
    110562401 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110562401 (Nfkbia)
   04131 Membrane trafficking [BR:mun04131]
    110562401 (Nfkbia)
Transcription factors [BR:mun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    110562401 (Nfkbia)
Membrane trafficking [BR:mun04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110562401 (Nfkbia)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 110562401
NCBI-ProteinID: XP_021514797
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP
AAAEPWKQQLTEDGDSFLHLAIIHEEKTLTLEVIRQVKGDLAFLNFQNNLQQSPLHLAVI
TNQPGIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTPQHLSSILQATN
YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGRLTLENLQLLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccagccggccacggccaggactgggccatggagggcccgcgggacggcctg
aagaaggagaggctggtggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgcgagatccgcctgcagccgcaggaggcgcct
gcggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gccatcatccacgaagagaagaccctgaccctggaagtgattcgtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagagtccactgcacttggccgtgatc
accaaccagccaggaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctccatcttgcctgtgagcagggctgcctggccagcgtg
ggagtcctcacgcagacctgcacaccccagcatctcagctccatcctgcaggccaccaac
tacaatggccacacgtgtctgcacctggcctcgatccacggctacctgggcatcgtggag
catttggtgtcactgggtgctgatgtcaatgctcaggagccctgcaatggtcgaacggcc
ctccatctcgcagtggacctgcagaaccccgaccttgtctcgctcctgctgaagtgtggg
gctgacgtcaatagagtcacttaccaaggctactctccgtaccagcttacttggggccgg
ccgagtacccggatacagcagcagctgggcaggctgaccctggagaatcttcagctgctg
ccggagagcgaggatgaggagagctatgacacagagtcggaattcacggaggatgagctg
ccctacgatgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system