KEGG   Meriones unguiculatus (Mongolian gerbil): 110552883
Entry
110552883         CDS       T05884                                 

Gene name
Cul3
Definition
(RefSeq) cullin-3 isoform X1
  KO
K03869  cullin 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110552883 (Cul3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110552883 (Cul3)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     110552883 (Cul3)
DNA repair and recombination proteins [BR:mun03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     110552883 (Cul3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 110552883
NCBI-ProteinID: XP_021500163
LinkDB
Position
Unknown
AA seq 778 aa
MTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVT
EHLINKCITSGGTCCQFMPLLVMLTLITWCSPDFFTVKVREDVLNSLNNNFLQTLNQAWN
DHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIA
RERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSA
SVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKN
GKTEDLACMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKS
RFDRFLQESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVET
ILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKL
EGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRH
AFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKH
ILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKS
KEIESGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRI
MKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgcaattcaa
gaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaatgcatat
acaatggttttgcataaacatggagaaaagctctacactggactaagagaagttgttact
gaacatctcataaataagtgcatcacatcaggaggcacatgctgtcagtttatgccatta
ttggtgatgttaactttgatcacttggtgttcgccagatttcttcactgtaaaggtgcga
gaagatgtactaaattcactgaataacaactttcttcaaacactaaatcaagcttggaat
gatcatcaaacagccatggtgatgattagagacatactaatgtatatggaccgtgtatat
gtacaacaaaataatgtagaaaatgtctacaatttgggattaataatttttcgagatcaa
gttgtacgttatgggtgtattagggatcatcttcggcaaactttattggatatgattgcc
agagagcggaaaggagaagttgtagacagaggagcaataagaaatgcttgccagatgtta
atgattttaggtcttgaaggaagatcagtctatgaggaagattttgaggctccttttttg
gaaatgtctgcagaattttttcagatggaaagccagaaatttttagcagaaaacagtgct
tcagtatatataaagaaagtagaagctagaattaatgaggaaatagagcgggtgatgcac
tgccttgacaaatctacagaagagcccattgtgaaggttgttgagagggaactcatttct
aagcacatgaaaactattgtagaaatggaaaattctgggctggtacatatgttgaaaaat
ggaaagacagaagaccttgcttgtatgtacaaattatttagtcgtgtgccaaatggtttg
aagacaatgtgtgaatgtatgagttcttatttgagggaacaaggaaaagcccttgtttct
gaggaaggagaagggaagaatcccgttgactatatccagggcttattggatctgaagagt
aggtttgatcgctttctccaagaatccttcaataatgaccggctcttcaaacagactatt
gctggggactttgagtatttcctaaacctcaactccaggtctcctgaatacctctcatta
tttattgatgataagctgaaaaagggagtcaaagggctaaccgaacaagaagtagaaaca
atattggataaggcaatggtcctttttaggtttatgcaagaaaaagatgtatttgaacgt
tattataaacaacacctggcaaggagactgctcacaaataaaagtgtttctgatgactct
gaaaaaaatatgatttctaaattaaagactgagtgtggatgtcagttcacatcgaaactg
gaaggaatgtttagggatatgagcatctcaaacacaactatggatgagttcaggcaacat
ctacaggcaacgggggtatctttaggtggtgttgatctcacagtccgggttctcacaacg
ggatattggcctactcagtcagccacaccaaagtgcaacatcccaccagcaccaagacat
gcttttgagatatttagaaggttctacttagccaaacacagtgggcgacaactcacactc
cagcatcacatgggttctgcagatctcaatgccaccttttatggtccggttaaaaaggaa
gatggatctgaggttggcgttggtggtgcacaagtaactggttctaatacccgaaagcac
atactgcaagtctccactttccagatgaccatattaatgctcttcaataatagagagaaa
tacacatttgaggaaattcaacaagaaacagatattcctgaaagagaacttgttagagcc
ctccagtccctcgcctgtggtaaaccaacacagcgggtcctcacaaaagaacccaagtca
aaggagatagaaagtggccacatatttacagttaatgatcagttcacatccaaactacac
agagtcaagattcaaacagttgcagccaaacaaggtgaatccgacccagaaaggaaagaa
acaagacagaaagtagatgatgacagaaaacacgagatagaagctgctatagtgcgaata
atgaagtctagaaagaagatgcagcacaatgttttagtagcagaggtaactcagcaattg
aaggctcgattcttaccaagtccagttgttattaagaaacgtattgaaggacttattgag
agagaatatttggcacgaacacctgaggatcgcaaagtatacacatacgtagcataa

DBGET integrated database retrieval system