KEGG   Meriones unguiculatus (Mongolian gerbil): 110553013
Entry
110553013         CDS       T05884                                 

Gene name
Pdpk1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun03320  PPAR signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04510  Focal adhesion
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04722  Neurotrophin signaling pathway
mun04910  Insulin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04931  Insulin resistance
mun04960  Aldosterone-regulated sodium reabsorption
mun05145  Toxoplasmosis
mun05205  Proteoglycans in cancer
mun05213  Endometrial cancer
mun05215  Prostate cancer
mun05223  Non-small cell lung cancer
mun05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110553013 (Pdpk1)
   04071 Sphingolipid signaling pathway
    110553013 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    110553013 (Pdpk1)
   04152 AMPK signaling pathway
    110553013 (Pdpk1)
   04150 mTOR signaling pathway
    110553013 (Pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110553013 (Pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    110553013 (Pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110553013 (Pdpk1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110553013 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    110553013 (Pdpk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110553013 (Pdpk1)
   03320 PPAR signaling pathway
    110553013 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    110553013 (Pdpk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110553013 (Pdpk1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110553013 (Pdpk1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110553013 (Pdpk1)
   05231 Choline metabolism in cancer
    110553013 (Pdpk1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110553013 (Pdpk1)
   05213 Endometrial cancer
    110553013 (Pdpk1)
   05223 Non-small cell lung cancer
    110553013 (Pdpk1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110553013 (Pdpk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110553013 (Pdpk1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110553013 (Pdpk1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110553013 (Pdpk1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   110553013 (Pdpk1)
Membrane trafficking [BR:mun04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    110553013 (Pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 110553013
NCBI-ProteinID: XP_021500390
LinkDB
Position
Unknown
AA seq 559 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTESSSAPGIPSGVSRQGPTMDSTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYEPLKAHPFFESITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAVDASLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQRYQSHPDAAVQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgttcccattcagtccagtgtggtgcta
tgttcctgcccgtccccatcaatggtgaggtcccagactgagtccagctcggcccctggc
attcctagtggtgttagcaggcagggacccactatggacagcaccacagccgaagcccga
ccaagcaccaaccccttgcagcagcatcctgcccagctgccaccacagcctcgaaagaaa
cggcctgaagacttcaagtttgggaaaattcttggggagggctccttttctacagttgtt
ctggcccgagaactggccacttccagagaatatgccattaaaattctggagaagcgtcat
attataaaagagaacaaagtcccgtacgtaactagagagagagatgtgatgtcacgcctg
gatcaccccttctttgtgaaactttactttacatttcaggatgatgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacatccgcaaaattggttcattt
gatgagacctgtacccggttttacacagctgaaattgtgtctgcattagagtacttgcat
ggcaagggcatcattcacagagaccttaagccagaaaacattttgttaaatgaagacatg
cacatccagatcacagattttggaacagcaaaagtgctatccccagagagcaaacaagca
agggccaactcatttgtaggaacagcacagtatgtttctccagagctgctcacagagaag
tcggcgtgtaagagttcagacctttgggctcttggatgtataatctatcagcttgtggca
ggactaccaccgttcagagccggaaatgaatatcttatatttcagaagatcattaaactg
gaatatgatttcccagagaaattcttccctaaggcgagggatcttgtggaaaaacttttg
gttttagatgccacaaagcgtttaggctgtgaagagatggaagggtacgagcctctcaaa
gctcatccgttctttgagtccatcacatgggaaaatctgcaccagcagacacctccgaag
ctcacagcttacttgccagccatgtcagaggatgatgaagactgctatggcaactacgac
aatctcctgagccagtttggctgcatgcaggtgtcatcctcctcctcttcccactctttg
tctgcggtggatgccagcctgccccagaggtcgggcagcaacatagagcagtacatccat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaggttg
ttattggaaaaacaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggtccagtggataaacgaaagggtttatttgcaagacgacggcagttatta
ctcacagaagggccacatttatattatgttgatcctgtcaacaaagtcttgaaaggtgaa
attccatggtcacaagaactccgaccagaggccaagaattttaaaactttctttgtccac
acgcctaacaggacatattacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcagcggtaccagagtcatccagatgctgctgtgcagtga

DBGET integrated database retrieval system