KEGG   Meriones unguiculatus (Mongolian gerbil): 110553240
Entry
110553240         CDS       T05884                                 

Gene name
Traf3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04064  NF-kappa B signaling pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110553240 (Traf3)
   04668 TNF signaling pathway
    110553240 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110553240 (Traf3)
   04621 NOD-like receptor signaling pathway
    110553240 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    110553240 (Traf3)
   04657 IL-17 signaling pathway
    110553240 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553240 (Traf3)
   05203 Viral carcinogenesis
    110553240 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110553240 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110553240 (Traf3)
   05160 Hepatitis C
    110553240 (Traf3)
   05171 Coronavirus disease - COVID-19
    110553240 (Traf3)
   05164 Influenza A
    110553240 (Traf3)
   05162 Measles
    110553240 (Traf3)
   05168 Herpes simplex virus 1 infection
    110553240 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110553240 (Traf3)
   05169 Epstein-Barr virus infection
    110553240 (Traf3)
   05165 Human papillomavirus infection
    110553240 (Traf3)
SSDB
Motif
Pfam: zf-TRAF ATG16 zf-C3HC4_2 zf-C3HC4 Crescentin MPS2 Spc7 Spc29 Cast Tropomyosin_1 zf-RING_6 KxDL T3SSipB FliJ BLOC1_2 DUF1664 GAS Exonuc_VII_L DUF3450 SPATA24
Other DBs
NCBI-GeneID: 110553240
NCBI-ProteinID: XP_021500730
LinkDB
Position
Unknown
AA seq 566 aa
MEASKKMDASGSLQPNPPLKLQPDRSAGAVLVPEQGGYREKFVKAVEDKYKCEKCHLVLC
NPKQTECGHRFCESCMAALLGSSSPKCTACQESIIKDKVFKDNCCKREILALQICCRNEG
RGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCNHCK
SQVPMVTLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPD
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggaggcaagcaaaaagatggatgcttctggctcactgcagcccaacccacccttgaag
ctacagcccgatcgcagcgcaggggcggtgctcgtgccggagcaaggaggctaccgggag
aagtttgtgaaggcagtggaggacaagtataagtgcgagaagtgccacctggtgctgtgc
aacccaaagcagactgagtgtgggcaccggttttgtgagagctgcatggctgccctgctc
ggctcctcaagtccaaaatgtacagcgtgccaagaaagtatcatcaaagacaaggtgttt
aaggataattgctgcaagagagagattctggcccttcagatctgctgtcggaatgaaggc
agaggctgtgcagagcagctgaccctggggcacctgctggtgcacctaaaaaatgaatgc
cagtttgaggaacttccctgtctgcgtgctgactgcaaagaaaaagttctgagaaaagac
ttgcgagatcatgtggaaaaggcctgtaaataccgagaggccacgtgcaatcactgcaag
agccaagtgcccatggtcacactgcagaaacatgaagacactgactgtccctgtgtggtg
gtatcttgtcctcataagtgcagtgtccagacgcttctgaggagtgagttgagtgcacac
ttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccatgaggccagctccgcggtacagcacgtaaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccttgctgcagaatgaaagt
gttgaaaaaaacaagagtatacaaagtttgcataatcagatatgtagctttgaaattgaa
atcgagagacaaaaggaaatgcttcgaaacaatgaatccaaaatccttcatctgcagcga
gtaatagacagccaagcagagaaactgaaagaactcgacaaggagatccgtccgttccgg
cagaactgggaggaagcagacagcatgaagagcagtgtggagtccctccaaaaccgtgtg
actgagctggaaagtgtggacaaaagtgcagggcaggcggctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgctgagtgttcatgacatccgcttggccgac
atggacctgcggttccaggtcctcgagactgccagctataacggtgtgctgatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctgtctctctac
agccagcctttctacacaggttattttggctacaagatgtgtgccagggtctacctgaat
ggggacggaatggggaaagggacacacctgtcgctcttctttgtcattatgcgtggggaa
tacgatgctctgttgccgtggccgttcaagcagaaagtgacactcatgctgatggatcag
gggtcctccagacgccatctgggagatgcgttcaagcctgatcccaacagcagcagcttc
aagaagcccactggagagatgaacatcgcttctggctgcccagtgtttgttgcccagact
gttctagagaacgggacgtacattaaagatgatacaatttttattaaagtcatagtggat
acttctgatctgcctgac

DBGET integrated database retrieval system