KEGG   Meriones unguiculatus (Mongolian gerbil): 110553267Help
Entry
110553267         CDS       T05884                                 

Gene name
Sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00051  Fructose and mannose metabolism
mun01100  Metabolic pathways
Module
mun_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110553267 (Sord)
   00051 Fructose and mannose metabolism
    110553267 (Sord)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110553267 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 110553267
NCBI-ProteinID: XP_021500763
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MAAPAKAENLALVVHGPGDIRLENYPVPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDF
VVKKPMVLGHEAAGTVTKVGAMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPTIFFC
ATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCG
AGPVGMVTLLVAKAMGAAQVVVTDLSAPRLTKAKELGADFTIQVAKETPQELASKVESLL
GGKPEVTIECTGAESSIQTGIYATRSGGTLVIVGMGSEMTSLPLVHAAVREVDIKGVFRY
CNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETSKKGLGLKVMIKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagctaaggccgagaacctggccctagtagtacacggacctggggacatt
cgtttggagaactacccagttccagaacctggcccaaatgaggtgctactgaagatgcat
tctgtgggcatctgcggctctgatgttcactactggcagcatggccgaattggagatttt
gttgtgaaaaagccaatggtgctggggcatgaagctgctggaacggtcaccaaagtagga
gcgatggtgaagcatctaaaaccaggtgatcgggtggctatcgagcctggggttcccaga
gaaatagatgaattctgcaagatcggtagatacaacctgacgccaactatcttcttctgt
gccacgccccccgacgacgggaatctctgccgcttctacaagcacaatgctgatttctgc
tacaagcttcctgacagtgtcacctttgaagaaggagccctgattgagcctctgtctgtg
gggatctatgcctgccgtcgaggttcagtttctctggggaacaaggtcctcgtgtgtggg
gctgggccagttgggatggtcactttgcttgtggccaaagcaatgggagctgctcaagtg
gtggtgactgatctatctgcccctcggttgaccaaagccaaggaacttggagccgatttt
accatccaggttgccaaggagacccctcaggagcttgccagtaaggtggaaagtctgttg
gggggcaagccagaggtcaccattgagtgcactggagcagaatcctccatccagacgggc
atctacgccactcgctctggcgggaccttggtgattgtgggaatgggctctgagatgacc
agtttacccctggtgcacgcagctgttcgggaggtggatatcaagggcgtgtttcgatac
tgcaacacgtggccaatggcgatttccatgcttgcatcgaagactttgaatgtaaagcct
ctagttacccacagattccctctggagaaggctgtagaagcctttgaaacatccaaaaag
ggactggggctgaaagttatgatcaagtgtgaccccaatgaccagaacccctaa

DBGET integrated database retrieval system