KEGG   Meriones unguiculatus (Mongolian gerbil): 110553592
Entry
110553592         CDS       T05884                                 

Gene name
Rb1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04110  Cell cycle
mun04218  Cellular senescence
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110553592 (Rb1)
   04218 Cellular senescence
    110553592 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553592 (Rb1)
   05203 Viral carcinogenesis
    110553592 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110553592 (Rb1)
   05225 Hepatocellular carcinoma
    110553592 (Rb1)
   05226 Gastric cancer
    110553592 (Rb1)
   05214 Glioma
    110553592 (Rb1)
   05220 Chronic myeloid leukemia
    110553592 (Rb1)
   05218 Melanoma
    110553592 (Rb1)
   05219 Bladder cancer
    110553592 (Rb1)
   05215 Prostate cancer
    110553592 (Rb1)
   05224 Breast cancer
    110553592 (Rb1)
   05222 Small cell lung cancer
    110553592 (Rb1)
   05223 Non-small cell lung cancer
    110553592 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110553592 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110553592 (Rb1)
   05161 Hepatitis B
    110553592 (Rb1)
   05160 Hepatitis C
    110553592 (Rb1)
   05163 Human cytomegalovirus infection
    110553592 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110553592 (Rb1)
   05169 Epstein-Barr virus infection
    110553592 (Rb1)
   05165 Human papillomavirus infection
    110553592 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110553592 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110553592 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110553592 (Rb1)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110553592 (Rb1)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    110553592 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 110553592
NCBI-ProteinID: XP_021501270
LinkDB
Position
Unknown
AA seq 927 aa
MPPKAPRRAAPAAAEPPPPPPPPPPPPPRDDDPEQDSSPEELPLARLEFEEIEEPEFTAL
CQKLKVSDHVRERAWLTWEKISSVDGILEGYIQKKKELWGLCIFVAAVDLDEMPFTFTEL
QKTIETSVYKFFDLLKEIDTSTKVDNAVSRLLKKYNVLCALYSKLERTCELIYLTQPSSV
ISTEINPMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYK
TAVMPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGIVSSNGLPEVESLSKRYEELYRKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKN
NPDEEASMLTPHTPVRTVMNTIQQLMVILNSASDQPSENLIAYFNNCTVNPKENILKRVK
DVGHIFKEKFANAVGQGCIDIGAQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEA
NLTRDMIKHLERCEHRIMESLAWLSGSPLFDLIKQSKDGEGPDHLESACPLSLPLQSNHT
AADMYLSPIRSPKKRSSTTRVSSVANTETQAASAFHTQKPLKSTSLSLFYKKVYRLAYLR
LNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKF
KIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASPRPPTLSP
IPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGQPTPTKMTPRSRILVSIGESFGT
SEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHIPVESKFQQKL
AEMTSTRTRMQKQKMNDSMDISNKEEK
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagagccgcgccggccgccgccgagcccccgccgccgccg
ccgccgccgccgccgccgccgcctcgggacgacgaccccgagcaggacagcagccccgaa
gagctgcccctggccaggcttgagtttgaagaaattgaagaacctgaatttactgcatta
tgccagaagttaaaggtatccgatcatgtcagagaaagagcttggttaacttgggagaaa
atttcatctgtggatggaatcctggaaggatatattcagaagaagaaggaactctggggc
ctctgcatcttcgttgcagcagtcgacctggatgagatgccatttacttttactgagcta
cagaaaaccatagaaaccagtgtctataaattcttcgacttactaaaagaaattgatacc
agtaccaaagttgataatgctgtgtcaagattattgaagaagtataatgtgttatgtgca
ctctacagcaaattagaacggacatgtgaacttatatatttgacacaacccagcagtgtg
atatctactgaaataaatcctatgttggtgctaaaaatttcttggatcacttttttacta
gctaaaggagaagtgttgcaaatggaagatgatctggtaatctcatttcagttaatgttg
tgtgtagttgactattttattaagttctcacctcctgcactactcagagaaccatacaaa
acagctgtaatgcccattaatggttcaccccgaacacccagaagaggtcagaacaggagt
gcccggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatcccttttatg
aattcacttggaattgtatcatctaatggacttccagaggttgaaagtctctctaaacgc
tatgaagaactttatcgtaaaaacaaagatttagatgcaagactatttttggatcatgat
aaaacacttcagactgatccaatagacagctttgaaacagaaagaactccacgaaaaaac
aaccctgacgaagaggcaagcatgcttactccacacactccagttaggactgtaatgaat
actatccaacaattaatggtgattttaaattctgcaagtgatcaaccatcagaaaacctg
attgcctatttcaataattgcacagtgaatccaaaagaaaatatcctgaaaagagtaaag
gatgttggacacatctttaaagagaagtttgctaatgctgtggggcagggatgtattgac
atcggagcacagcgatataaacttggggtccgattgtattatcgagtgatggaatccatg
cttaaatcagaagaagaacgtttatccattcagaattttagcaaactcctaaatgacaac
atctttcatatgtccttattggcctgtgctcttgaagttgtgatggcaacatatagcagg
agtacatcacagaatcttgattctggaacagatttgtccttcccgtggattcttaatgta
cttaatttaaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaagcc
aacttgacaagagatatgataaaacatttagaaagatgtgaacatcgaattatggaatcc
cttgcatggctttcaggctcacctttatttgatctcattaagcagtccaaggatggagaa
ggacctgatcaccttgaatctgcttgtcctctcagcctccctctccagagtaaccacact
gcagcagacatgtatctttctcctataagatctccaaagaaaagaagttcaactacacgt
gtaagttctgttgcaaatacggagacacaagcagcgtccgccttccatacgcagaagcca
ttgaaatctacctccctttccctgttttacaaaaaagtgtaccgcttagcgtatctccgg
ctgaacacgctgtgtgcacggctcctgtctgaccacccggaactagagcacatcatctgg
accctgtttcagcatacactgcaaaatgagtatgagcttatgagagaccgacatttggac
cagattatgatgtgttcaatgtatggcatctgcaaagtgaagaacatagacctgaaattc
aaaatcatcgtaactgcgtacaaggatcttcctcatgctgcccaggagacctttaaacgt
gttttgatcagagaagaggagtttgattccattatagtattctataactcagttttcatg
cagaggctaaaaacaaatattttacagtatgcctcccccaggcctcctaccttgtcacca
atacctcacatccctcgaagtccttacaagttttctagttcacccttacggattcctgga
ggcaacatctatatatcacctctaaagagcccttataaaatttcagaaggtcagccaaca
cccacaaaaatgactccaagatcaagaatcttggtctcaattggtgaatcatttgggact
tctgagaagttccagaaaataaaccaaatggtgtgtaatagtgaccgagtgctcaaaaga
agtgctgaaggtggcaacccccccaaaccactgaaaaagctgcgctttgacatcgaggga
tccgatgaagcagatgggagtaaacatatcccagtggagtccaaattccaacagaaactg
gcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatggat
atttcaaacaaggaggaaaagtga

DBGET integrated database retrieval system