KEGG   Meriones unguiculatus (Mongolian gerbil): 110553918
Entry
110553918         CDS       T05884                                 

Gene name
Irf7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110553918 (Irf7)
   04621 NOD-like receptor signaling pathway
    110553918 (Irf7)
   04622 RIG-I-like receptor signaling pathway
    110553918 (Irf7)
   04623 Cytosolic DNA-sensing pathway
    110553918 (Irf7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110553918 (Irf7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110553918 (Irf7)
   05160 Hepatitis C
    110553918 (Irf7)
   05164 Influenza A
    110553918 (Irf7)
   05162 Measles
    110553918 (Irf7)
   05168 Herpes simplex virus 1 infection
    110553918 (Irf7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110553918 (Irf7)
   05169 Epstein-Barr virus infection
    110553918 (Irf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110553918 (Irf7)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110553918 (Irf7)
SSDB
Motif
Pfam: IRF-3 IRF MBD
Other DBs
NCBI-GeneID: 110553918
NCBI-ProteinID: XP_021501900
LinkDB
Position
Unknown
AA seq 426 aa
MAVERGPQRVLFSEWLLGEVSSGQYEGLQWLNEAHTVFRVPWKHFGRKDLDEADARIFKA
WAVARGRWPPSGYNLPPPEAEAAERAGWKTNFRCALNSTKRFILHKDNSGDPADPHKVYK
LSLESGSAEGPAMENRAEVTLSNALHTQVLQYSFLEDHLLESESGADSVPPQAHGWEQEH
ASEEPHAAWQVEAAPVPRFQQPALMTERNLAFLNVTIMYKGRTVHQETVGHPSCVFLYSP
MGSAITSVPQPVIFPSPAELPDQKQLHYTEMILQHVSPGLQLELRGPSLWALRMGKCKVY
WEVGSPMGSTNPSTQAQLLERNCQTPIFNFSTFFQELEEFRARRRQRSPHYTIYLGFGQD
LSAGRPKEKSLILVKLEPWLCKARLEGVQREGASSLDSSSLGLCLSSTNSLYDDIEHFLM
DLGQWY
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggccgtagagaggggtccccagcgtgtgctgttcagcgagtggctgctgggtgaggtc
agcagcggccagtatgaggggctgcagtggctgaacgaggctcacacggtcttccgtgtg
ccctggaagcatttcgggcgcaaggatctggatgaagccgatgcacgcatcttcaaggcc
tgggctgtggcccgagggaggtggccacctagtggatataacttgccacccccagaggct
gaggccgccgagcgagcaggctggaaaaccaacttccgatgcgcactcaacagcacgaag
cgctttatcttgcacaaggacaattcaggagaccctgcggatccgcacaaggtgtacaag
ctgagcctggagtctggatctgctgaaggccccgccatggaaaatagggcagaggtgacc
ctcagcaatgccctacacacccaggttctgcaatacagcttcctggaggaccacctactg
gaatctgagtctggggcagattcagtcccaccacaagctcacggctgggagcaagaacat
gcttcggaggagccccatgcagcatggcaggtggaagctgctcctgtccccaggtttcaa
cagccagccctgatgaccgagcgcaacctagctttcctgaatgtaaccatcatgtacaag
ggccgcacagtgcaccaggaaacagtggggcaccccagctgcgtgttcctgtatagcccc
atgggctcagcgataacctcagtgccccagccggtgattttccccagccccgctgaactc
ccagatcagaagcagctgcactacactgagatgattctgcagcacgtgtctccaggcctc
cagctggagctgcgtgggccttcactgtgggccctgcgcatgggcaagtgcaaggtgtac
tgggaggtgggcagccccatgggctccacgaacccctccacccaagcccagctgttggag
cgcaactgccagacccccatcttcaacttcagcaccttcttccaagagttggaggagttt
cgggcccggaggcggcaaagatcaccacactacaccatctacctgggttttggacaagat
ttgtcagcagggaggcccaaggagaagagcttgatcctggtgaagctggagccatggcta
tgcaaggcccgcctggaaggggtgcagcgcgagggtgcatcctccctggacagcagcagt
cttggcctgtgcctgtctagcaccaacagtctctatgatgacatcgagcacttcctcatg
gatctgggtcagtggtattag

DBGET integrated database retrieval system