KEGG   Meriones unguiculatus (Mongolian gerbil): 110554001
Entry
110554001         CDS       T05884                                 

Gene name
Grk3
Definition
(RefSeq) beta-adrenergic receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04062  Chemokine signaling pathway
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04724  Glutamatergic synapse
mun04740  Olfactory transduction
mun05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110554001 (Grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110554001 (Grk3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110554001 (Grk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110554001 (Grk3)
  09157 Sensory system
   04740 Olfactory transduction
    110554001 (Grk3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110554001 (Grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110554001 (Grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110554001 (Grk3)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     110554001 (Grk3)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   110554001 (Grk3)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110554001 (Grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like
Other DBs
NCBI-GeneID: 110554001
NCBI-ProteinID: XP_021501997
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKAAPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIDEAVPQVKFYEEIKEYEKLDNEEDRLRRSRQMYDAYIMRELLSC
THQFSKQAVEHVQRHLSKKQVTATLFQPYIEEICESLRGEIFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTSYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCCGGGAQEVKEHSFFRGIDWQHVYLRKYSPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVVDTIYAAVNADTDKIEARR
RAKNKQLGQEEDYALGKDCIMHGFMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDRKCILFRIKGGKQFVLQCESDPEFAQWLKELTHTFTEAQRLLRR
APKFLHQQRATILEFSKPPLCHKTSSGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aaggcggcgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgc
agcgtgatgcagaggtatcttgcagagagaaacgaaataacctttgacaagattttcaac
cagaaaatcggcttcttgctttttaaggacttctgtctgaatgaaatcgacgaagcagtg
ccacaggtgaagttttatgaagagataaaagaatacgagaaactggacaacgaagaggac
cggctgcgccggagccggcagatgtacgatgcctacatcatgagggagctcctgtcctgc
acgcaccaattctccaagcaagctgtggaacatgtccagcgccatctctccaagaaacag
gtgacagctactctttttcagccgtacatagaagaaatctgtgaaagccttcgaggggag
attttccaaaagttcatagaaagcgataaattcaccagattctgtcagtggaagaatgtg
gagttaaacatacacctgaccatgaacgacttcagcgtgcacaggatcattggccgagga
gggtttggggaagtttacggctgcagaaaagcggacacggggaaaatgtacgccatgaag
tgcttggacaagaagagggtgaagatgaagcagggggagacgctggccttgaacgaaagg
atcatgctgtccctcgtcagcaccggggactgtcccttcattgtctgcatgacctacgcc
ttccacacaccagacaaactctgcttcatcctggacctgatgaacgggggtgacatgcat
taccacctctcccagcacggggtgttttccgagaaggagatgcgcttttatgccagcgag
atcatcctgggtcttgagcacatgcacacccgatttgttgtctacagagacctgaagcct
gcgaacatcctcctggatgaacatgggcatgtgaggatatccgatctcggcctcgcctgt
gatttctccaagaagaagccacatgccagtgtgggcacccacgggtacatggctcccgag
gtgttgcagaagggcacatcctatgacagcagcgctgactggttctccctgggctgcatg
ctcttcaagcttctgcggggccacagccctttcagacagcacaaaaccaaagacaagcat
gagatagaccgcatgaccctaacggtgaacgtgcagcttcccgatgccttctcccctgag
ctgaggtccctcctggaggggctgctccagcgggacgtgagccagcggctgggatgctgt
ggaggcggggcacaggaggtgaaggagcactccttcttcaggggcattgactggcagcac
gtgtacttgcggaagtactcgccgcccctaatcccgcctcggggagaggtcaacgcagcg
gatgcctttgacatcggctcctttgatgaggaggacaccaaaggcattaagctgctggac
tgtgaccaggatctctacaagaacttcccgctggtgatctctgagcgctggcagcaggaa
gtggtggacaccatctacgccgccgtcaacgccgacacggataagatcgaggcccggagg
agagctaaaaacaagcagctgggtcaggaggaagattacgccctgggaaaggactgcatc
atgcacgggttcatgctgaagctggggaaccccttcctcacgcagtggcagagacgctac
ttttacctgttccccaacagactggagtggagaggagagggcgagtctcggcaaaattta
ctgaccatggaacagatcttgtctgtggaggagacccagattaaagacagaaaatgcatt
ttattcagaataaagggagggaagcaatttgtcttgcagtgcgagagtgaccctgagttc
gcacagtggctgaaggagctgacccacaccttcaccgaggcccaacggctgctgcgccgg
gcccccaagttcctccaccagcagcgtgccaccatcctggagttctccaagccaccgctg
tgtcacaaaaccagcagcggcctctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560356
Entry
110560356         CDS       T05884                                 

Gene name
Grk2
Definition
(RefSeq) beta-adrenergic receptor kinase 1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04062  Chemokine signaling pathway
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04724  Glutamatergic synapse
mun04740  Olfactory transduction
mun05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110560356 (Grk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110560356 (Grk2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110560356 (Grk2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110560356 (Grk2)
  09157 Sensory system
   04740 Olfactory transduction
    110560356 (Grk2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110560356 (Grk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110560356 (Grk2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110560356 (Grk2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     110560356 (Grk2)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   110560356 (Grk2)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110560356 (Grk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 110560356
NCBI-ProteinID: XP_021511885
LinkDB
Position
Unknown
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLAC
SHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggccgacctggaggcagtgctggccgatgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgccggagcccagcatccgc
agcgtcatgcagaagtatctcgaggaccgaggagaagtgacctttgaaaagatcttctca
cagaagttagggtacctgcttttccgagacttctgcctgaaccatctggaagaggccaag
cccttggtggagttctatgaagagatcaagaaatatgagaagctggagacagaagaggag
cgtgtggtccgcagccgggagatctttgactcctacatcatgaaagaactactggcctgc
tcacaccccttttcaaagaatgctaccgagcatgtccaaggccacctggtgaagaagcag
gtgcctccagacctcttccagccatacattgaggagatctgtcagaacctccgaggggat
gtattccagaagttcattgagagtgacaagttcacacggttctgccagtggaagaatgta
gaactcaacatccatctgaccatgaatgacttcagtgtgcatcgaatcatcgggcgtggg
ggcttcggtgaggtctatgggtgccggaaagcagacacaggcaagatgtacgccatgaag
tgtctggacaagaaacgcatcaagatgaagcagggagagaccctggctctgaacgagcgg
atcatgctttcccttgtcagcaccggggactgccccttcatcgtgtgcatgtcatatgca
ttccacacaccagacaagctcagtttcatcctggatctcatgaacggtggggacctgcac
taccacctctctcagcatggagtcttctctgaggccgacatgcgcttctacgcagctgag
attatcctgggtcttgaacacatgcacaaccgttttgtagtctacagggacctgaagcca
gccaacattctcctggacgagcatggccacgtgagaatctcggaccttggcctagcctgt
gacttctccaagaagaagccccatgccagtgtgggcacgcacgggtacatggcgcctgaa
gtgctacagaagggcgtagcctacgatagcagtgctgactggttctccctgggctgcatg
ctcttcaagttgttgcggggacacagccccttccggcagcacaagaccaaagataagcat
gagattgatcgcatgacattgacaatggctgttgagctgcctgattccttctcccctgaa
ctccggtccctgctggaaggcttgctgcagagggatgtcaatcggaggctaggctgtctg
ggccgaggggctcaggaggtaaaagaaagccccttcttccgctccctggactggcagatg
gtcttcttacagaagtacccacctccactgatccccccacgtggggaggtgaatgcagcg
gatgcttttgacattggctcttttgatgaggaggacacgaaaggaatcaagttattggac
agcgaccaggagctctaccgcaacttccctctcaccatctcggagcggtggcagcaggag
gtggcagagactgtctttgacaccatcaacgctgagacagaccggctggaggcacgaaag
aaagccaaaaacaagcagctgggccacgaggaagactatgccctgggtaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccccaaccggctcgagtggcggggtgaaggagaggctccgcagagcctc
ctgaccatggaagagatccagtcggtggaagaaacgcagatcaaggaacgcaagtgtctc
ctgcttaagatccgcggtggcaagcagtttgtcctgcagtgcgatagtgatcctgagctg
gtgcagtggaaaaaagagctgcgtgacgcgtaccgtgaggcccagcagctggtgcagcga
gtgcccaagatgaagaacaagccacgctcacctgtggtggagctgagcaaggtgccactg
atccagcgtggcagtgccaacggcctctga

DBGET integrated database retrieval system