KEGG   Meriones unguiculatus (Mongolian gerbil): 110554727
Entry
110554727         CDS       T05884                                 

Gene name
Iqce
Definition
(RefSeq) IQ domain-containing protein E isoform X1
  KO
K24677  IQ domain-contaning protein E
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110554727 (Iqce)
SSDB
Motif
Pfam: IQ
Other DBs
NCBI-GeneID: 110554727
NCBI-ProteinID: XP_021503224
LinkDB
Position
Unknown
AA seq 858 aa
MSEGTADLASETGDDSLSAITFDSDVETKTKRKVFQKPPPTSPKSPYSSKSKKVTPWRAL
KTTGSMPLSSRMSLTPQKLWIGGGSKQGSGTQPLSSTHPSEHAWTHPPSCTPDYLTEAVK
AKRADLKRSGSHGHGSGTSVYREKEDMYDEIIELKKSLHMQKSDVDLMRTKLRRLEEENS
RKDRQIEQLLDPGRGSDFVRTLAEKRPDTGWVITGLKQRIFRLEQQCKEKDNTINKLQTD
MRTTNLEEMRVAMETYYEEIHRLQTLLASSEATGKKPILDKKLGVKRQKKMSSALLNLTR
SVQELTEENQSLKEDLDRMLSNSPTVSKIKGYVDWSKPRLLRRIAELEKKVGSAESPKTA
ATPELVKSNPVVHSSSNNMVQKQPKEDQPKEEQPKGDQSEDQEQLRKTVTSLKGERRTLQ
AQLLERDLEMKQLLQAKVHLEKELEMIREGEKERQEREQALREKVEALANKCQELEEAKR
QERNSFLAIELAEAKRRDRDSSAPVEERYSSVAETHEADPELHAPSPCSGPSRPVSNNEP
DFHDSASDRGGSWLPTPSPEERREAAVRTLQARWKAHRHKKRKAALDEAATVLQAAFRGH
LARSKLVRSKAPDSGSPSVLSAPSLPNQLQSSPTPHTPSPGSLAEDSPVQQEAITAIQSI
LRGYLAQARFIANCCRGLAAASQREAVAAMCWEPTSPPSLAASPGKDNQESSGEAAKDEE
EAEEPAGLQPNSGAIRAGLCAKETLRETAPGEPAPSSQQPLVPQRTTSDSSQGGQWDCSS
PSSLEAVPESSVKDVMCPGMCEERSSSTRSASPSQAESCPQGLQPVSPRPVEGFYSEDSD
DDIIFSPFLPRKKSPSPF
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgagcgagggcacagcagatctggcctcggagacgggagatgatagtctgtctgcgatc
acttttgattctgacgttgagacgaaaacaaaaagaaaggttttccagaaacctcctccc
acatcaccaaagtcaccttactcctccaagtccaaaaaagtgacaccctggcgtgctctg
aagacaacaggaagtatgcctctgagtagcagaatgtctctgaccccgcagaagctgtgg
ataggaggaggatcgaaacagggaagtgggacccagcccctgagctccacacatccctcg
gagcacgcgtggacccatccccccagctgcactcctgactacttgacagaagccgtgaaa
gcgaagagggcagacctcaagcgttctggcagccatggtcacggctctgggacatctgtg
tacagagagaaggaggacatgtatgatgaaatcattgagttgaagaagtccttacatatg
cagaaaagtgacgtggatctgatgagaacaaaacttcggcgcctggaagaggagaatagc
agaaaggatcggcagatagagcagcttttggatccagggcgaggctcagacttcgtgcgg
accctggcagagaaaaggcctgatactggttgggttatcaccgggctcaagcaaaggatc
ttcaggctggagcaacagtgcaaggaaaaggacaacactatcaacaaactgcaaaccgac
atgaggaccaccaacctggaggagatgcgcgtcgccatggagacgtactacgaagagatc
catcgtctgcagaccctcctggcgagctctgaagccacaggaaagaagcccattcttgat
aagaagctgggtgtgaagaggcagaagaagatgagcagcgctctgctgaacttgactcgg
agcgtgcaggaactgacagaggagaaccagagcctgaaggaggacctggaccgcatgctg
agcaattcccctactgtctccaaaataaagggttatgtagattggagcaagccccggctg
ctgagacgcattgcagagctagaaaagaaagtgggctctgcagaaagcccgaagacggca
gctaccccagagctggtcaagtcgaatcccgtggtccactcctcatcaaacaacatggta
caaaagcagccgaaagaggaccagcccaaggaggagcagcccaaaggggatcagtcggag
gatcaggagcaactccgaaaaaccgtgacaagcctgaagggggagcggaggacgctgcaa
gcgcagctgctggagagagacctagagatgaagcagctgctacaggccaaggtccacttg
gagaaggagctggagatgatcagggaaggcgagaaggagaggcaggagcgagagcaggct
ttgagagagaaagttgaagccctcgccaacaaatgtcaagaactggaagaagctaagaga
caagagagaaattcattcttagcgatagagctggcagaagctaagagacgagacagagat
tcttctgcaccagtagaagagagatattcttccgtggcagagactcatgaggccgaccca
gagctccacgctccctcaccctgcagcgggccctccaggccagtctccaacaatgagccc
gacttccacgacagcgccagcgacaggggtggctcctggctccccacgccgtcccccgaa
gagaggagagaggctgccgtcaggaccctgcaggcccggtggaaggcccacagacacaag
aaaagaaaagcagctttggatgaggcagcaactgtgctccaggcggccttcaggggacac
ctagctcggtcgaagctggtacgcagcaaagctccagactctgggtctcccagcgtgctg
agcgcccccagccttcccaaccagctgcagagctctcccacaccccataccccaagccct
ggctccctggcagaagacagtccagtacaacaggaggccatcactgccatccagtccatc
ctccggggatacctggcccaggccaggttcattgccaactgctgcagaggactagccgcc
gcgtctcagagggaagctgtggcagccatgtgctgggaacccacctccccaccctccctc
gcagcttctcctgggaaagacaaccaggagagcagtggggaggctgccaaggatgaagag
gaggcagaggagccggcaggcctgcagcccaactcaggagcaataagagcaggcctctgt
gccaaggagacgctgagggagactgctccaggcgaacctgccccctcctcacagcaaccc
ttggtcccccaaaggaccacctcagactcctcccaaggtggccagtgggactgctcatcc
ccatccagtctagaggctgtgcctgagtccagtgtaaaggatgtgatgtgcccgggtatg
tgtgaggaaaggagcagcagcaccagaagtgccagtccatcccaggcagagtcctgtccc
caaggactgcagcccgtgtcaccacgacctgtggagggcttctattcggaagactccgat
gacgacattatcttttcgccatttctgcccagaaagaaaagcccctccccattctag

DBGET integrated database retrieval system