KEGG   Meriones unguiculatus (Mongolian gerbil): 110555051
Entry
110555051         CDS       T05884                                 

Gene name
Xylb
Definition
(RefSeq) xylulose kinase isoform X1
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun01100  Metabolic pathways
Module
mun_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110555051 (Xylb)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     110555051 (Xylb)
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 110555051
NCBI-ProteinID: XP_021503706
LinkDB
Position
Unknown
AA seq 547 aa
MDGRTHRRPAGSPRTMGRRCCLGWDFSTQQVKVVAIDAELSIFYEDSVHFDRDLPEFGTQ
GGVHVHKDRLTVTSPVLMWVQALDLILEKMKASGFDFSQVLALSGAGQQHGSVYWKAGAS
RTLSSLSPSLPLHQQLQACFSISDCPVWMDSSTTAQCRRLEAAVGGARALSCLTGSRAYE
RFTGNQIAKLSQQDPEAYSHCERISLVSSFAASLFLGGYSPIDYSDGSGMNLLQIQEKVW
SQACLAACAPHLEEKLGSPVPSCSVVGAISSYYVQRYGFSPGCQVVAFTGDNPASLAGMR
LEEGDIAVSLGTSDTLFLWLREPMPALEGHIFCNPVDEQHYMALLCFKNGSLMREKIRDE
SASCSWNKFSKALQSTEIGNKGNLGFYFDVMEITPEIIGRHRFNAENIEVSAFPGDVEIR
ALIEGQFLAKRIHAEGLGYRVMPKSKILATGGASHNKDILQVLADVFGAPVYVIDTTSSA
CVGSAYRAFHGLAGGTGVPFSEVVKSAPHPSLAATPSPGASQVYEALLPRYAELEQRILS
RARGPLE
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggacggacggacgcacagacggccagcgggaagcccccggaccatgggccgccgctgt
tgcctggggtgggacttcagcacgcagcaggttaaagttgttgctattgatgccgagctg
agcatcttctacgaggacagtgtgcattttgacagagacctacctgaatttggaactcag
ggcggtgtccatgtacacaaggacaggctgacggtcacctctccggtcctgatgtgggtc
caggctctggacctgatcctggagaagatgaaggcttccggcttcgacttctctcaagtt
ctagccttatctggagcaggccagcaacatggaagcgtttactggaaggctggagccagc
cggacattgtcaagcctgtcaccttctctcccattacatcagcagctgcaggcctgcttc
tccattagcgactgcccggtatggatggattccagtaccacggcccagtgtcgccggttg
gaggctgctgtaggtggagccagggctctcagctgcctcacggggtcacgggcctatgag
cgttttacggggaaccagatagcgaagctttcccagcaggaccctgaggcctactcgcac
tgtgagagaatttccttggtcagtagctttgctgcttcgctgttcctgggtggatactcg
cccatcgactacagtgatggttctggaatgaacttgttacagatccaggaaaaagtctgg
tcccaagcttgccttgccgcctgtgccccccatctggaggaaaagctcggctcacccgtc
ccttcatgctcagttgtgggagccatttcttcctactatgtccagcgctacggattctct
ccaggatgccaagtggtggcctttactggggacaacccggcgtcactggcaggcatgagg
ctggaggaaggtgacattgcggtcagcctgggcaccagtgacaccctgtttctctggctc
cgggagcccatgcctgccttggaaggccacatcttctgcaatccggtggacgagcagcac
tacatggccctcctgtgctttaaaaatggctccctcatgagagagaagatccgagacgag
tctgcttcctgttcctggaacaagttctccaaggccctgcagtccacagagatagggaac
aagggaaacttgggtttttattttgatgtaatggagatcacccctgaaattatcgggcgt
cataggtttaatgcagaaaacattgaggtctctgcattcccgggggatgtggagattcga
gcactgattgaaggacagttcctggccaagaggattcatgcagaaggcctgggctaccga
gtcatgcccaagtcaaagattctggccacgggaggagcatctcacaataaggacatcctg
caggtgcttgcagatgtttttggggcccctgtgtatgtcatagacaccaccagttcggcc
tgcgtgggctctgcataccgagcttttcatggccttgcaggagggacgggtgtgcccttt
tcagaggttgtgaaatcagctccacatcccagcctggcagccacgccgagtccaggagct
tcccaggtctacgaggccctgctccctcgatacgctgaactggaacagagaatcttgtct
cgcgcccggggacctctggaatga

DBGET integrated database retrieval system