KEGG   Meriones unguiculatus (Mongolian gerbil): 110555059
Entry
110555059         CDS       T05884                                 

Gene name
Myd88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun05132  Salmonella infection
mun05133  Pertussis
mun05134  Legionellosis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05144  Malaria
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110555059 (Myd88)
   04064 NF-kappa B signaling pathway
    110555059 (Myd88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110555059 (Myd88)
   04621 NOD-like receptor signaling pathway
    110555059 (Myd88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110555059 (Myd88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110555059 (Myd88)
   05135 Yersinia infection
    110555059 (Myd88)
   05133 Pertussis
    110555059 (Myd88)
   05134 Legionellosis
    110555059 (Myd88)
   05152 Tuberculosis
    110555059 (Myd88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110555059 (Myd88)
   05161 Hepatitis B
    110555059 (Myd88)
   05171 Coronavirus disease - COVID-19
    110555059 (Myd88)
   05164 Influenza A
    110555059 (Myd88)
   05162 Measles
    110555059 (Myd88)
   05168 Herpes simplex virus 1 infection
    110555059 (Myd88)
   05169 Epstein-Barr virus infection
    110555059 (Myd88)
  09174 Infectious disease: parasitic
   05144 Malaria
    110555059 (Myd88)
   05145 Toxoplasmosis
    110555059 (Myd88)
   05140 Leishmaniasis
    110555059 (Myd88)
   05142 Chagas disease
    110555059 (Myd88)
   05143 African trypanosomiasis
    110555059 (Myd88)
SSDB
Motif
Pfam: TIR Death TIR_2
Other DBs
NCBI-GeneID: 110555059
NCBI-ProteinID: XP_021503723
LinkDB
Position
Unknown
AA seq 366 aa
MSEAFVQILTPSRGGQWPGPPTALQCGLRILARGGASRKAKEGGPDRSRRGSRKLNRRAH
RTALGRGWLAMSERSPPVGSVRLDSSMHSLPLAALNVGVRRRLSLFLNLRTLVAADWTSL
AEEMGFEYLEIRELESRPDPTRSLLDAWQGRSGASVGRLLDMLALLDRQDILLELKDLIE
DDCRKYLVNKQKQESEKPLQVPRVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPS
DIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQS
KECDFQTKFALSLSPGVQQKRLIPIKYKVMKREFPSILRFITICDYTNPCTKSWFWTRLA
KALSLP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtcagaggcgtttgtccagattctcacgccttcaagaggagggcagtggccgggcccc
ccaactgctctccagtgtggactccggattctagcaaggggcggagcttctcggaaagcg
aaagaaggagggcctgacaggagtcgtaggggaagtaggaagctcaacaggcgagcgcac
cggaccgccttgggtcgggggtggctcgccatgtcggaaagaagccctcccgtgggatct
gtgcgcctggactcctccatgcactccctccccttggccgcgctcaacgtgggagtgcgg
cgccgcctctcgctgttcttgaacctacggacgctggtggcggccgactggacctcgctg
gcggaggagatgggcttcgagtacttggagatccgagaactggagagtcgccccgacccc
acccgcagtctgttggatgcctggcaggggcgctctggcgcgtcggtcggcaggctgcta
gacatgctggccctgctggaccggcaagatatactgctggaactgaaggacctcatcgag
gatgactgcaggaaatacttagtaaataagcagaagcaggagtctgagaagccgttgcag
gtgcccagagtggaaagcagtgtcccacaaacaaaggagctgggcggcatcacgactctt
gatgaccctctgggacagacaccggagcttttcgacgccttcatctgctactgccccagt
gatattgaattcgtgcaggagatgatccggcagctcgaacagacagactatcggctgaag
ctgtgtgtgtccgaccgtgatgtcctgccaggcacctgcgtctggtctattgccagtgag
ctcattgagaaaaggtgtcgccgcatggtggtggttgtttctgacgattacctacagagc
aaggaatgtgacttccagaccaagtttgccctcagcctctccccaggtgtccaacagaag
aggctgattcccatcaagtacaaggtgatgaagagggagttccccagtatcctgaggttc
atcaccatctgcgactataccaatccttgcaccaagtcctggttctggacccgccttgcc
aaggctttgtccctgccctga

DBGET integrated database retrieval system