KEGG   Meriones unguiculatus (Mongolian gerbil): 110555127
Entry
110555127         CDS       T05884                                 

Gene name
Tp53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04071  Sphingolipid signaling pathway
mun04110  Cell cycle
mun04115  p53 signaling pathway
mun04137  Mitophagy - animal
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04216  Ferroptosis
mun04218  Cellular senescence
mun04310  Wnt signaling pathway
mun04722  Neurotrophin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05216  Thyroid cancer
mun05217  Basal cell carcinoma
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110555127 (Tp53)
   04310 Wnt signaling pathway
    110555127 (Tp53)
   04071 Sphingolipid signaling pathway
    110555127 (Tp53)
   04151 PI3K-Akt signaling pathway
    110555127 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110555127 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    110555127 (Tp53)
   04210 Apoptosis
    110555127 (Tp53)
   04216 Ferroptosis
    110555127 (Tp53)
   04115 p53 signaling pathway
    110555127 (Tp53)
   04218 Cellular senescence
    110555127 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110555127 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110555127 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    110555127 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110555127 (Tp53)
   05202 Transcriptional misregulation in cancer
    110555127 (Tp53)
   05206 MicroRNAs in cancer
    110555127 (Tp53)
   05205 Proteoglycans in cancer
    110555127 (Tp53)
   05203 Viral carcinogenesis
    110555127 (Tp53)
   05230 Central carbon metabolism in cancer
    110555127 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110555127 (Tp53)
   05212 Pancreatic cancer
    110555127 (Tp53)
   05225 Hepatocellular carcinoma
    110555127 (Tp53)
   05226 Gastric cancer
    110555127 (Tp53)
   05214 Glioma
    110555127 (Tp53)
   05216 Thyroid cancer
    110555127 (Tp53)
   05220 Chronic myeloid leukemia
    110555127 (Tp53)
   05217 Basal cell carcinoma
    110555127 (Tp53)
   05218 Melanoma
    110555127 (Tp53)
   05219 Bladder cancer
    110555127 (Tp53)
   05215 Prostate cancer
    110555127 (Tp53)
   05213 Endometrial cancer
    110555127 (Tp53)
   05224 Breast cancer
    110555127 (Tp53)
   05222 Small cell lung cancer
    110555127 (Tp53)
   05223 Non-small cell lung cancer
    110555127 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110555127 (Tp53)
   05014 Amyotrophic lateral sclerosis
    110555127 (Tp53)
   05016 Huntington disease
    110555127 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110555127 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110555127 (Tp53)
   05161 Hepatitis B
    110555127 (Tp53)
   05160 Hepatitis C
    110555127 (Tp53)
   05162 Measles
    110555127 (Tp53)
   05168 Herpes simplex virus 1 infection
    110555127 (Tp53)
   05163 Human cytomegalovirus infection
    110555127 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110555127 (Tp53)
   05169 Epstein-Barr virus infection
    110555127 (Tp53)
   05165 Human papillomavirus infection
    110555127 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110555127 (Tp53)
   01522 Endocrine resistance
    110555127 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110555127 (Tp53)
   03036 Chromosome and associated proteins [BR:mun03036]
    110555127 (Tp53)
   03400 DNA repair and recombination proteins [BR:mun03400]
    110555127 (Tp53)
Transcription factors [BR:mun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    110555127 (Tp53)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110555127 (Tp53)
DNA repair and recombination proteins [BR:mun03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110555127 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 110555127
NCBI-ProteinID: XP_021503848
LinkDB
Position
Unknown
AA seq 390 aa
MEEPQSDLSIEPPLSQETFSDLWKLLPPKNLLSALEPMEDLLLPQDVTSWLGDADEALPV
CTAPAEGPAPEAPAPAAPAPPASWPLSSFVPSHKTFQGNYGFRLGFLQSGTAKSVTCTYS
PSLNKLFCQLAKTCPVQLWVSSAPPPGTRVRAMAIYKNSQHMTEVVRRCPHHERCSENEA
SDPRGRAPPQHLIRVEGNLHAEYVDDRQTFRHSVLVPYESPEVGSDCTTIHYNYMCNSSC
MGGMNRRPILTIITLEDPSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKQRCPELPQGS
AKRALPTNTSSSPQSKRKPADGEYFTLKIRGRKRFEVFRELNEALELKDAQAAGESGDGR
AQASCLKTKKDKSTSPRKNPMIKREEPDSD
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaagagccacagtcggatctcagcattgagccccctctgagtcaggagacattttca
gacctgtggaaactgcttcctccaaagaaccttctgtccgccttagagcctatggaggat
ctactgctgccccaggatgtgacaagctggttgggagacgcggacgaggccctccccgtg
tgcacagctccggcggagggccctgcgcctgaggcccccgcaccagcggcccctgcaccg
cccgcttcctggcccctgtcatcctttgtcccttcccataaaaccttccagggcaactat
ggcttccgtctgggcttcctgcaatccgggacagccaagtctgtcacatgcacgtactcc
ccttccctcaataagctgttctgccagctggcaaagacatgccccgtgcagctgtgggtc
agctccgccccaccccctggcacccgcgtccgcgccatggccatctacaaaaactcacag
cacatgacagaggttgtgcgacgctgcccacaccacgagcgctgctcggaaaacgaagcg
tccgatccgcgtggaagggcccctccccagcatctgatccgcgtggaagggaacctgcat
gccgagtacgtggacgacaggcagaccttccgccacagcgtgctggtgccctatgagtcg
cccgaggtcggctctgactgcaccaccatccactacaactacatgtgtaatagctcctgc
atgggcggcatgaaccgccggcccatcctcaccatcatcacgctggaagaccccagtggc
aacctgctgggccggaacagctttgaggtccgcgtttgcgcatgtcctgggagagaccgc
cgcacagaggaagaaaatttacgcaaaaagcaacgttgcccagagctgccgcaagggagt
gctaagcgagccctgcccaccaacaccagctcctctccccagtcaaagaggaaaccagct
gacggagaatatttcaccctcaagatccgtgggcggaaacgcttcgaggtcttccgggag
ctgaatgaagccttggaactgaaggatgcacaggctgcaggggagtcgggagatggcagg
gcgcaggccagctgtctgaagaccaagaaggacaagtctacctcccctcggaagaatccg
atgatcaagagagaggagcctgattcagactga

DBGET integrated database retrieval system