KEGG   Meriones unguiculatus (Mongolian gerbil): 110555164
Entry
110555164         CDS       T05884                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110555164
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 110555164
NCBI-ProteinID: XP_021503901
LinkDB
Position
Unknown
AA seq 174 aa
MRCFTSLVLGLLALEVALAQNRQENVFNLVQSLCSKASISESTECINNQDEKCAQNPMCC
SGSCISTCKTSINTDVPKAGCCSWNPRLVIPNERNPESLCSRNSDCPDNMKCCSFGCAVR
CDIPRAGSFLCSAKMAPAGKRRAAWTPAGSAQQPRFRRRGDDVRSAPVRVEAVR
NT seq 525 nt   +upstreamnt  +downstreamnt
atgcgttgcttcaccagcctcgttctcggcctgctggccctggaggtggcccttgctcag
aaccgacaggaaaatgtcttcaacttagttcagtccctgtgttctaaagccagcatcagt
gagagcaccgagtgtatcaacaaccaggatgagaagtgtgcccagaatcccatgtgttgc
tctggttcctgcatcagtacctgcaaaacttccatcaacactgatgtccccaaagctggc
tgctgctcctggaatccacgcctggtgatccctaatgagcgaaacccagagagcctatgc
tccaggaacagtgattgtcctgacaacatgaaatgctgcagctttggctgtgccgtgagg
tgtgatatcccacgagcaggaagcttcctgtgctcagcaaagatggcgcctgccgggaag
aggagagcggcgtggactccggctggcagcgctcagcaacctcgcttccggcggcgcgga
gatgacgtaaggagcgcgccggtccgcgtggaggcggtgcgctga

DBGET integrated database retrieval system