KEGG   Meriones unguiculatus (Mongolian gerbil): 110555185
Entry
110555185         CDS       T05884                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00230  Purine metabolism
mun01100  Metabolic pathways
mun01522  Endocrine resistance
mun04015  Rap1 signaling pathway
mun04020  Calcium signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04072  Phospholipase D signaling pathway
mun04114  Oocyte meiosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04261  Adrenergic signaling in cardiomyocytes
mun04270  Vascular smooth muscle contraction
mun04371  Apelin signaling pathway
mun04540  Gap junction
mun04611  Platelet activation
mun04713  Circadian entrainment
mun04714  Thermogenesis
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04727  GABAergic synapse
mun04740  Olfactory transduction
mun04750  Inflammatory mediator regulation of TRP channels
mun04911  Insulin secretion
mun04912  GnRH signaling pathway
mun04913  Ovarian steroidogenesis
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04918  Thyroid hormone synthesis
mun04921  Oxytocin signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04925  Aldosterone synthesis and secretion
mun04926  Relaxin signaling pathway
mun04927  Cortisol synthesis and secretion
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04962  Vasopressin-regulated water reabsorption
mun04970  Salivary secretion
mun04971  Gastric acid secretion
mun04972  Pancreatic secretion
mun04976  Bile secretion
mun05032  Morphine addiction
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110555185 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110555185 (Adcy3)
   04371 Apelin signaling pathway
    110555185 (Adcy3)
   04020 Calcium signaling pathway
    110555185 (Adcy3)
   04072 Phospholipase D signaling pathway
    110555185 (Adcy3)
   04024 cAMP signaling pathway
    110555185 (Adcy3)
   04022 cGMP-PKG signaling pathway
    110555185 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110555185 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110555185 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110555185 (Adcy3)
   04062 Chemokine signaling pathway
    110555185 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    110555185 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    110555185 (Adcy3)
   04912 GnRH signaling pathway
    110555185 (Adcy3)
   04913 Ovarian steroidogenesis
    110555185 (Adcy3)
   04915 Estrogen signaling pathway
    110555185 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    110555185 (Adcy3)
   04921 Oxytocin signaling pathway
    110555185 (Adcy3)
   04926 Relaxin signaling pathway
    110555185 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    110555185 (Adcy3)
   04918 Thyroid hormone synthesis
    110555185 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    110555185 (Adcy3)
   04916 Melanogenesis
    110555185 (Adcy3)
   04925 Aldosterone synthesis and secretion
    110555185 (Adcy3)
   04927 Cortisol synthesis and secretion
    110555185 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110555185 (Adcy3)
   04270 Vascular smooth muscle contraction
    110555185 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    110555185 (Adcy3)
   04971 Gastric acid secretion
    110555185 (Adcy3)
   04972 Pancreatic secretion
    110555185 (Adcy3)
   04976 Bile secretion
    110555185 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110555185 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110555185 (Adcy3)
   04727 GABAergic synapse
    110555185 (Adcy3)
   04725 Cholinergic synapse
    110555185 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    110555185 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    110555185 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    110555185 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    110555185 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    110555185 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110555185 (Adcy3)
   04714 Thermogenesis
    110555185 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110555185 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    110555185 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110555185 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110555185 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110555185 (Adcy3)
   05163 Human cytomegalovirus infection
    110555185 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110555185 (Adcy3)
Enzymes [BR:mun01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110555185 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 110555185
NCBI-ProteinID: XP_021503948
LinkDB
Position
Unknown
AA seq 1145 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGVGLVVDII
LFVLCKKGLLPDRVSRRVVPYLLWLLISAQIFSYLGLNFSRAHAASDTVGWLAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELQGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPVSSKPSSPALIETKEPNGSAPAS
SSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSMAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANV
VDMLSCLQYYMGPYNVTSGMELDGGCMENPKYYSYVAVLSLIATIMLVQVSHMVKLTLML
LVTSAVTAINLYAWSPIFDEYDHKRFQGQDSPVVALEKMQALPTPGLNGTDSRLPLVPSK
YSMTLMVFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagcggagtac
tcggtcagcctgccctctgaccccgaccgcggggtcggccggacccatgaaatctctgtg
cggaactcggggtcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctatttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcggccctcttcgactgctacgtggtcgtcatgtgcgccgtggtcttc
tccagcgataagctggcgcccctcatggtggctggcgtcggcctggtggtggacatcatc
ctgttcgtgctctgcaaaaaggggctgctcccggaccgagtgagccgtagggtggtcccc
tacctgctgtggctgctcatctcagcccagatcttctcctacctgggcctgaacttctcg
cgagcccacgcagccagcgacacggtgggctggctggccttctttgtcttctccttcttc
ataacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgtgttgtg
cacacgctcgtcctgggggtcactgtggcccagcagcagcaagaggagctgcaagggatg
cagctgctgagggagatcctggccaatgtcttcctctacctgtgcgccatcatcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgccgaagcacgtggctgatgagatgttgaaggacatgaagaaggatgagagt
cagaaggaccagcaacagtttaacaccatgtacatgtaccggcatgagaacgtcagcatc
ctgtttgcagatattgtgggcttcacccagctgtcctccgcttgcagtgcccaggagctc
gtgaagctactcaatgagctctttgcccgctttgacaagctggcagcgaaataccaccag
ctgaggatcaagattctcggggactgttactactgcatctgcggcctgcctgactaccga
gaggaccacgccgtgtgctccatccttatggggctcgccatggtggaggccatctcgtat
gtgagggagaagaccaagactggcgtggacatgcgtgtgggcgtgcacacgggcactgtg
ctgggtggtgtcctgggccagaagcgctggcagtatgatgtgtggtctactgatgtcact
gtggcaaacaagatggaggctggtggcatcccagggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtagagcctggtgatgggggcagtcgctgtgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagcgcaaaatggcctcaacggctcggctctgccaaatggagcgccggtgtcctcc
aaacccagctcccccgccctcattgagaccaaggagcccaatgggagtgcccctgccagc
agctccacctcagaggaggccgaagagcaggaggcccaggctgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggctgaccgcgtggtggatgcctctgag
gacgagcacgaattgaaccagctgctcaacgaggccctgctggagcgggagtctgcccag
gtggtaaagaagagaaacaccttcctcctaaccatgcgcttcatggacccagagatggaa
acgcgctactccgtggagaaggagaagcagagcggggctgccttcagctgctcctgcgtg
gttctgttctgcacggccatggtggagatcctcattgacccctggctgatgacaaactac
gtgaccttcgtggttggggaggtcctgctcttgatcctgaccatctgctcgatggctgcc
atctttcccagggcgtttcctaagaagctcgtagccttctcgtcttggattgaccggacc
cgctgggccaggaatacctgggccatgttggccatcttcattctggttatggccaacgtt
gtggatatgctcagctgtcttcagtactacatgggaccttacaatgtgacttccgggatg
gagctggacggcggctgtatggagaaccccaagtactacagctacgttgctgtgctgtct
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatgctg
ctcgtcaccagcgcggtgacggccatcaacctgtacgcctggagtcccatctttgatgaa
tacgaccacaagcgctttcagggacaggactctcctgtggtggccttagagaagatgcag
gcactccccacccctgggctcaatggcaccgacagcaggttgcccctggtgccttccaag
tactcaatgaccctgatggtgtttgtcatgatgctgagcttttactatttctcgcgccac
gtggaaaagctggcccgaacactgtttttgtggaagattgaggtccatgaccagaaagaa
cgcgtctatgagatgcgacggtggaacgaggccttggtcaccaacatgctgcctgagcac
gttgcccgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gacgagattggagtcatgtttgcctccctgcccaacttcgccgacttctacactgaggag
agcatcaataacggtggcattgagtgtctgcgcttcctcaatgagatcatctctgatttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagc
acctacatggcagcctcaggagtcaccccagacgtcaacaccaatggctttacaagctcc
agcaaggaggagaagtcagacaaggagcgctggcagcacttggctgacctggcggacttt
gctttagccatgaaggacacgctcaccaacatcaacaaccagtcattcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggttctagccggagtcattggagcccggaaacca
cactatgacatctggggcaacacggtcaatgtggccagcaggatggaatccacaggggtc
atgggcaacatccaggtggtagaagaaacgcaggtcatccttcgagagtatggcttccgc
tttgtgaggcgaggccccatctttgtgaagggcaaaggggagcttctgaccttcttcttg
aaggggcgggacaggccagctgccttccccaatggctcctctgttacgctgccccaccaa
gtggtggacaactcctga

DBGET integrated database retrieval system