KEGG   Meriones unguiculatus (Mongolian gerbil): 110555272
Entry
110555272         CDS       T05884                                 

Gene name
Ciita
Definition
(RefSeq) MHC class II transactivator isoform X1
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04612  Antigen processing and presentation
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05164  Influenza A
mun05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110555272 (Ciita)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    110555272 (Ciita)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110555272 (Ciita)
  09172 Infectious disease: viral
   05164 Influenza A
    110555272 (Ciita)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110555272 (Ciita)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110555272 (Ciita)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mun04054]
    110555272 (Ciita)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110555272 (Ciita)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: Other
  TAF1 family
   110555272 (Ciita)
Pattern recognition receptors [BR:mun04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110555272 (Ciita)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_8 LRR_4 LRR_9
Other DBs
NCBI-GeneID: 110555272
NCBI-ProteinID: XP_021504081
LinkDB
Position
Unknown
AA seq 1204 aa
MNHFQAILAQVRTLLSSQQPRQVQALLDGLLEEELLSREYHCALLHEPDGEALARKISLT
LLEKGDLDSAFLSWVCSRLQAPVVERDTSYWDHAGRSLCATMELGSLEGSYLELLNSDAD
PLHLYHLYDQMDLAGEEEIELCSEPDTDTINCDQFSKLLQDMEGDEETREAYANIAELDQ
YVFQDSQLEGLGKDLFIEYIGAEEGCGRSTEVPGEAGRRPQKRRFPEEHTMDSKHGKLAE
PSMVPMLTGSFLMGPANLSTMPFLPPASSNQEPAPSHTDLEGAAQMPVSSSSSSLNCLDL
PAGHIQILTTLPQGLWQISGAGAGLSNVLIYHGEMPQVNQGLPSSSPTVPSLPKSPERPG
STSPFAPSAADLPNMPEPALTSRVNETEDTAPSLDQEDPESSNKLPKWPESVERFQHSLQ
DKYQLLPESLTGPLVAMELVRARLERGSNKSQERELATPDWTERQLAHGGLAEVLQVASD
CRRPRETQVIAVLGKAGQGKSHWARTVTYAWARGQLPQYDFVFYVPCHYLDRSGHTYHLR
DLLCPPSLQPLAMDDEVFGHIVRQPDRILLILDAFEELEAQEGLLHGPCGPLSSESCSLR
GLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADAIFEVPSFSIKQVQTYMRQYFENSG
TAETQDKALGLLEGQPFLLTHSHSPALCKTMCQLSKTLLEQGTEAQLPCTLTGLYVGLLG
PVARDSPPGALIELAKLAWELGRRHQSTLQETQFPSVEVKTWAVTQGLVQPALGTTEAQL
AFSSFLLQCFLGAVWLAQCSEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLTGLVFQPR
AHCLGALVEPAVAAGADRKRKVLTRYLKRLQLGTLRAGRLLELLHCAHETQEPGIWEHVA
RQLPGHLSFLGTRLTPPDVHVLGRALESASQDFCLDLRQTGIEPSGLGNLVGLSCVTGFR
ASLSDTMVLWESLQQQGEAKLLQAAEEKFTIEPFKAKSPKDVEDLDSLVQTQRLRNPSDD
AAKGLPAIQDLKTLEFSLGPILGPQAFPTLARILPAFSSLQHLDLDSLSENKIGDKGVSQ
LSATFPQLKALETLNLSQNSITDVGACELAEALPALAKSLLRLSLYNNCICDAGARSLAQ
VLPDMVSLRVMDVQFNKFTAAGAQQLASSLQKCPQVETLAMWTPTIPFGVQEHLQHLDAR
ISLR
NT seq 3615 nt   +upstreamnt  +downstreamnt
atgaaccacttccaggccatcctggcccaggtgcgaacactactctccagccagcagccc
aggcaggtgcaggccctcctggatggcctgctggaagaagagctgctctcacgggaatac
cactgtgctctgctccatgagcctgatggtgaggctctggccaggaagatttccctgact
ctgctggagaaaggggacttagactcagctttcttgagctgggtctgcagcaggctacag
gctccagtggtagagagagacaccagctactgggaccatgcaggccgtagtctgtgtgcc
accatggaactcgggtctctggagggcagctacctggagctccttaacagcgatgcggac
cccctacacctctaccacctctatgaccagatggacctggcgggggaggaggaaatcgag
ctctgctcagagcccgacacagacaccatcaactgcgaccagttcagcaagctgttgcaa
gatatggaaggggatgaagagacccgggaggcctatgccaacattgcggaactggatcag
tatgtgttccaggacagccagctggagggcctcggcaaggacctcttcatagagtatatt
ggagcagaggaaggctgtgggaggagtaccgaggtccctggagaagcaggaaggagacct
cagaagagacgcttcccagaagagcacactatggactcaaagcacgggaagctagctgag
ccctctatggtacccatgctgactggcagcttcctgatggggccagcaaacctctccacc
atgcccttcctaccacctgcttcgtccaatcaagagccagcacccagccacacagaccta
gagggagctgctcagatgcctgtgtcctcctctagctcctcactgaactgtttggatctc
cctgctgggcatatccagatcctcaccactctacctcagggactctggcaaatctcaggg
gctggcgcagggctctccaatgtcctaatctaccatggtgagatgccccaggtcaaccaa
ggactcccttcaagcagccccactgtccccagtcttcccaaatccccagagcggcccggc
tccaccagcccctttgcaccatctgcagctgacctgcccaacatgcccgaacctgcgctg
acctcccgtgtaaatgagacagaggatacagcaccctccctggaccaagaggatcccgag
tcttccaacaagcttccaaaatggccagagtctgtggagcggttccagcactccctgcag
gacaagtaccagctgttgcctgagagcctgaccggtcccctggtggccatggagctggtg
cgagccaggttggagagaggcagcaacaaaagtcaggaaagggaactggccactcctgac
tggacagagcgccagctagcccacggtggtctggctgaggtgcttcaggttgccagtgac
tgcaggcgaccacgagagacacaggtgatcgccgtgctgggtaaggccggccagggcaag
agccactgggcccgaactgtgacttatgcctgggcacgtggccagttgccacaatatgac
tttgtcttctatgtcccctgccattacttggatcgttcagggcacacgtaccacctacgg
gatttgctctgtcccccaagcctgcagccactggccatggatgatgaagtctttggtcac
attgtgaggcagccagaccgcatcctgctcattctagatgcttttgaggagctagaagcc
caagaaggcctcctgcatggaccatgtggacctctgtcctcagagtcctgttccctccgg
ggactgctagctgggcttttccagcggaagctgctgcgtggctgcaccctgctcctcaca
gcccgaccccggggccgcctggctcagagcctgagcaaggcagatgccatctttgaggta
cccagcttctctattaaacaggtccagacttacatgaggcaatactttgagaactcaggg
acagcggagacccaagacaaggccctgggcctcctggagggccagccttttctcctcacc
cacagtcatagccctgctctatgcaagaccatgtgtcagctctccaagaccctgctggaa
cagggaacagaggcccagttgccttgcacacttacagggctctatgttggcctgctaggc
cctgtagcccgggacagtcctccaggagccttaattgagctggctaagctggcctgggag
ctgggccgcagacaccaaagcaccttgcaagaaacccagtttccatcagtggaggtgaaa
acctgggcagtgacccaaggcttggtgcagcctgccctggggaccacagaggcccaactg
gccttctccagttttctgctacaatgcttcctgggtgctgtgtggctggcacagtgcagt
gaaataaaagacaaggagctgccacagtacctggccttgaccccaaggaagaagagacct
tatgacaactggcttgaaggtgtgccacgctttctgactggattggttttccagcctcgt
gcccactgcttgggggctctggtggagcctgcagtggctgcaggggcagacaggaaacgg
aaggttcttaccaggtacctgaagcgcctgcagctggggacacttcgggctgggaggttg
ctggagctgctgcactgtgctcacgagactcaggaacctgggatttgggagcacgtggca
cgtcaactccctgggcacctctccttcctgggcacccggctcacacccccagatgtacat
gtgctgggcagggccttagagtcggccagccaggacttctgcctggaccttcgtcagact
ggcattgagccctctggactgggaaacctcgtgggactcagctgtgtcaccggtttcagg
gcctcactgagtgacacaatggtgctatgggagtccctacagcagcagggagaggccaag
ctactccaggcagcagaggagaagttcaccattgagccatttaaggccaaatctccaaag
gatgtggaagacctggacagcctcgtgcagactcagaggctgagaaacccctcagatgat
gcagctaagggtcttcctgctatccaggaccttaagacgctagagttctcgctgggcccc
atcttgggcccgcaggctttccctacactggcaaggatccttccagccttctcctccctg
cagcacttggacctggactcacttagtgagaacaagatcggggacaaaggtgtgtcacag
ctctcagccaccttccctcagctgaaggccctggagactctcaacctgtcccagaatagc
atcactgatgtgggtgcctgcgagcttgcagaagcgcttccggccctagccaagtccctc
ctgaggctgagcttgtacaataactgcatctgtgacgcaggagccaggagcctggcacaa
gtgcttccagacatggtgtccctgcgggtgatggacgttcagttcaacaagttcacggct
gccggtgcccagcagctggcctccagccttcagaagtgtcctcaagtcgaaacgctggcg
atgtggacacccactatcccctttggggttcaggagcacctgcagcacctggatgccagg
atcagcctgagatga

DBGET integrated database retrieval system