KEGG   Meriones unguiculatus (Mongolian gerbil): 110555390
Entry
110555390         CDS       T05884                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun04012  ErbB signaling pathway
mun04062  Chemokine signaling pathway
mun04110  Cell cycle
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04360  Axon guidance
mun04390  Hippo signaling pathway
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04657  IL-17 signaling pathway
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04722  Neurotrophin signaling pathway
mun04728  Dopaminergic synapse
mun04910  Insulin signaling pathway
mun04916  Melanogenesis
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun05010  Alzheimer disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05135  Yersinia infection
mun05160  Hepatitis C
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05213  Endometrial cancer
mun05215  Prostate cancer
mun05217  Basal cell carcinoma
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110555390 (Gsk3b)
   04310 Wnt signaling pathway
    110555390 (Gsk3b)
   04340 Hedgehog signaling pathway
    110555390 (Gsk3b)
   04390 Hippo signaling pathway
    110555390 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    110555390 (Gsk3b)
   04150 mTOR signaling pathway
    110555390 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110555390 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110555390 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    110555390 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110555390 (Gsk3b)
   04657 IL-17 signaling pathway
    110555390 (Gsk3b)
   04662 B cell receptor signaling pathway
    110555390 (Gsk3b)
   04062 Chemokine signaling pathway
    110555390 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110555390 (Gsk3b)
   04917 Prolactin signaling pathway
    110555390 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    110555390 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    110555390 (Gsk3b)
   04916 Melanogenesis
    110555390 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110555390 (Gsk3b)
   04722 Neurotrophin signaling pathway
    110555390 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    110555390 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110555390 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110555390 (Gsk3b)
   05225 Hepatocellular carcinoma
    110555390 (Gsk3b)
   05226 Gastric cancer
    110555390 (Gsk3b)
   05217 Basal cell carcinoma
    110555390 (Gsk3b)
   05215 Prostate cancer
    110555390 (Gsk3b)
   05213 Endometrial cancer
    110555390 (Gsk3b)
   05224 Breast cancer
    110555390 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110555390 (Gsk3b)
   05020 Prion disease
    110555390 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    110555390 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110555390 (Gsk3b)
   04931 Insulin resistance
    110555390 (Gsk3b)
   04934 Cushing syndrome
    110555390 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110555390 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110555390 (Gsk3b)
   05162 Measles
    110555390 (Gsk3b)
   05163 Human cytomegalovirus infection
    110555390 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110555390 (Gsk3b)
   05165 Human papillomavirus infection
    110555390 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110555390 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110555390 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110555390 (Gsk3b)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     110555390 (Gsk3b)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   110555390 (Gsk3b)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110555390 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 110555390
NCBI-ProteinID: XP_021504252
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcggggcggccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttgggagcatgaaagttagcagagataaagatggcagcaaggtgaccacagtg
gtggcaactcctggacagggtcctgacagaccacaggaagtcagttatacagacactaaa
gttattgggaatggatcatttggtgtggtatatcaagctaaactttgtgattcaggagaa
ttggttgccatcaagaaagttctacaggacaaacgatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgattgcggtatttcttctactcaagtggt
gagaagaaagatgaggtctaccttaacctggtgctggactacgttccggaaacagtgtac
agagtggccagacactacagtcgagccaaacaaacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtttagcctatatccattcctttggaatctgccatcga
gatattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactatagggcgccagagttgatctttggagccactgattacacgtctagtatcgatgtg
tggtctgcaggctgtgtgttggctgagttgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaatttaaatttcctcaaatcaaggcacatcct
tggacaaaggtcttccgaccccgaactccaccagaggcaattgcactgtgtagccgtctt
ctggagtatacacctaccgcccgattaacaccactggaagcttgtgcacattcgtttttt
gatgagttacgggacccaaatgtcaaactacccaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggccaccatcctcattcctcct
catgctcggattcaagcagccgcgtcaacccctacaaacgccacagcagcctcggatact
aatgctggagaccgtggacagaccaataatgccgcttccgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system