KEGG   Meriones unguiculatus (Mongolian gerbil): 110555520Help
Entry
110555520         CDS       T05884                                 

Gene name
Cndp1
Definition
(RefSeq) beta-Ala-His dipeptidase
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00330  Arginine and proline metabolism
mun00340  Histidine metabolism
mun00410  beta-Alanine metabolism
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110555520 (Cndp1)
   00340 Histidine metabolism
    110555520 (Cndp1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110555520 (Cndp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110555520 (Cndp1)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     110555520 (Cndp1)
Peptidases and inhibitors [BR:mun01002]
 Metallo peptidases
  Family M20
   110555520 (Cndp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 110555520
NCBI-ProteinID: XP_021504448
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
KSRLIKQVFSPCNNKVIEAETGQRSLCHRNIGTPGALASSLLALLLLGQGMASSFSPPCS
GLLEKLFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQELFRMMALAADKLRQLGAGV
NSVDLGSQQMPDGQSLRIPPTILAELGNDAKKPTVCFYGHLDVQPAQREDGWLTDPYTLT
EVDGKLYGRGATDNKGPVLAWVNAVSAFRALGQDLPVNIKFILEGMEEAGSVALEELVKR
EKDRFFSSVDYIVISDNLWISQKKPALTYGTRGNCYFMVEVKCGKQDFHSGTFGGVLNEP
MADLVALLGSLVDSSGHILIPGIYDQMAPITEEDKAMYENIDLDLEEYQKSSQVEKFLFD
TKEELLAHLWRYPSLSIHGIEGAFDEPGAKTVIPSRVIGKFSIRLVPHMSLSVVETQVKQ
HLEAMFSERNSSNKMTISMVLGLRPWTANINDTQYLAARSAVRTVFGVDPDLIQDGSTIP
LAKIFQDITQKSVMMLPLGSVDDGEHAQNEKINRCNYIQGSKLLAAFFLELSKRRS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
aaaagcaggctaataaaacaggttttttccccctgtaataataaagtcattgaagcagaa
accggacagagaagcctctgtcacaggaacattgggactccaggggccttggcttcatct
ctcttggcgctgctgctgctggggcagggaatggcctcctccttctcccctccctgctct
gggctgctggagaagctcttccagtacatcgacctccaccaggacgagtttgtgcagacc
ctgaaggagtgggtggccattgagagtgactctgtgcagccggtgcctcggctccgacag
gagctcttccggatgatggccttggctgcagacaagctccgacagctgggagctggagtg
aattctgtagacttgggctctcagcagatgcctgatgggcagagtcttcgcatccctccc
accatactggctgagctgggaaatgatgccaagaagcccacggtatgcttttatgggcac
ttggacgtgcagccagcccagagagaggacggctggctcacagacccctatacactcaca
gaggtggatggaaaactctacggccggggagcaacagacaacaagggccctgtgctggcc
tgggttaatgctgtgagcgccttccgagctctgggacaggatcttcccgtgaacatcaag
ttcatcctggaagggatggaagaagctggttctgttgccctggaggaacttgtcaaaaga
gaaaaggaccgtttcttctccagcgtggactacattgtgatttcagacaacctatggatc
agccagaagaagcccgcgctcacttacggaacccgtgggaactgctacttcatggtggag
gtaaagtgtggaaagcaagatttccactcaggcacctttggtggcgtactcaacgaacca
atggctgacttggttgctcttctaggtagtctggtggactcatcaggccacatcctgatt
cctggaatctatgaccaaatggctcctattacagaggaggacaaagcaatgtatgagaat
attgatctggacctagaagaataccagaagagcagccaagttgagaaatttctgtttgat
accaaggaggaactcctggcacacctgtggaggtacccatctctctctatccatggcatc
gagggtgcgtttgatgagcctggagctaaaacagtcatccccagccgagttataggaaag
ttttcaatccgactggtcccgcacatgagtctgtctgtggtggagacacaggtgaaacaa
cacctggaagccatgttctctgaaagaaacagttccaacaagatgaccatctccatggtg
ctaggactccgcccatggacggcaaacatcaatgacactcagtacctcgcagcacgaagt
gccgtcagaacagtgtttggagtcgaccctgatctgatccaggacgggtcaaccattcca
cttgctaaaatatttcaggacatcacacaaaagagtgtgatgatgctcccgctgggctct
gtggatgacggagagcacgctcagaacgagaagatcaacaggtgcaactacatccagggg
tccaaattacttgccgctttttttctggagctgtcaaagcggcgctcatga

DBGET integrated database retrieval system