KEGG   Meriones unguiculatus (Mongolian gerbil): 110555551
Entry
110555551         CDS       T05884                                 

Gene name
Jak1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05212  Pancreatic cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110555551 (Jak1)
   04151 PI3K-Akt signaling pathway
    110555551 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110555551 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110555551 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110555551 (Jak1)
   04658 Th1 and Th2 cell differentiation
    110555551 (Jak1)
   04659 Th17 cell differentiation
    110555551 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110555551 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110555551 (Jak1)
   05203 Viral carcinogenesis
    110555551 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110555551 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110555551 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110555551 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110555551 (Jak1)
   05161 Hepatitis B
    110555551 (Jak1)
   05160 Hepatitis C
    110555551 (Jak1)
   05171 Coronavirus disease - COVID-19
    110555551 (Jak1)
   05164 Influenza A
    110555551 (Jak1)
   05162 Measles
    110555551 (Jak1)
   05168 Herpes simplex virus 1 infection
    110555551 (Jak1)
   05163 Human cytomegalovirus infection
    110555551 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110555551 (Jak1)
   05169 Epstein-Barr virus infection
    110555551 (Jak1)
   05165 Human papillomavirus infection
    110555551 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110555551 (Jak1)
   05140 Leishmaniasis
    110555551 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110555551 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110555551 (Jak1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110555551 (Jak1)
Protein kinases [BR:mun01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110555551 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl RIO1 SH2
Other DBs
NCBI-GeneID: 110555551
NCBI-ProteinID: XP_021504487
LinkDB
Position
Unknown
AA seq 1090 aa
MQYLNIKEDCNAMAFCAKMRSFRKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNHPITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKLQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELN
QSHSSDSGNVLYEVMVTGNHGIQWRQKPNELKLSSRGEALSFVSLVDGYFRLTADAHHYL
CTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFE
KSEVLGGQKQFKNFQIEVQKGRYSLHGSVDHFPTLRDLMNHLKKQILRTDNISFVLKRCC
QPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGTLLD
YKDDEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENI
MVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAR
EGIDSEIGPFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLW
EICYNGEIPLKDKTLVEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRD
INKLEEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQ
VAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSL
KEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGL
TKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSP
MTLFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPEEVYQLMRKCWEFQPSNRTTFQN
LIEGFEALLK
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agcttcaggaagacggaggtgaagcaggtagtccctgagccaggagtggaagtgaccttc
tatctgttggacagggagccactccgcctgggcagtggggagtacaccgctgaggagctg
tgcatcagggccgcccaggagtgcagtatttctcctctttgtcacaaccttttcgccctg
tacgatgagagcaccaagctctggtatgctccgaaccaccccatcactgtggatgacaaa
acgtctctccggctccactaccgcatgaggttctactttaccaactggcatggaaccaat
gacaatgaacagtctgtatggcgacattctccaaagaagcagaaaaatggatatgagaag
aaaaagattccagaagcaaccccgctgcttgacgccagttctctggagtatctgtttgca
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacagagcaa
gatggacatgacattgagaatgagtgcctggggatggctgtcctggccatctcacactat
gccatgatgaagaagttgcagttgccagaacttcccaaagacatcagctacaagagatat
attccagaaacattgaataaatccatcagacagaggaaccttcttaccaggatgcgaata
aataatgttttcaaggatttcctgaaagaatttaacaacaagaccatctgtgacagtagt
gtgtccacacatgatctgaaggtgaagtacctggctaccttggaaactttgacaaaacat
tatggagctgaaatatttgagacttctatgctactgatttcatcagaaaatgaattgaat
cagtcccactcgagtgacagtggcaacgttctctatgaagtcatggtgactggaaatcat
ggaatccagtggcggcagaaaccgaatgaactgaagctctcttctcgcggggaggccttg
tcgtttgtgtccctggtagatggctacttccggctcacagcggatgcccaccattacctc
tgcaccgatgtggctcccccactgattgtccacaatatacagaacggctgtcatggtcca
atctgcacagagtatgccatcaataagctgcggcaagaagggagtgaggaggggatgtac
gtgctgaggtggagctgcactgactttgacaacatccttatgactgtcacctgctttgaa
aagtctgaggtgttgggtggccagaagcagttcaagaactttcagattgaggtgcagaag
ggccgctacagcctgcatggctccgtcgaccactttcccaccctgagagacctcatgaac
caccttaagaagcagatcctacgcacggacaatataagctttgtgctgaagcgctgttgt
cagcctaagccccgagaaatctccaatctgctagtagccactaaaaaagcccaggaatgg
cagcccgtctaccccatgagccagctgagttttgatcggatccttaagaaagatattata
caaggtgagcaccttggtagaggcacaagaacacatatctattctgggaccctgctggac
tacaaggacgatgaaggaattgctgaagagaagaaaataaaagtgatcctcaaagtccta
gaccccagccacagggacatttctctggccttctttgaggcagccagcatgatgagacaa
gtttcccacaaacacattgtgtacctctatggtgtctgtgtccgagatgttgaaaatatc
atggtggaagagtttgtggagggaggaccactggatctcttcatgcaccggaaaagtgat
gtacttaccaccccctggaagttcaaagttgccaaacagctggccagtgccctgagttac
ttggaagataaagacttggttcatggaaatgtgtgcactaaaaacctcctcctggcccgt
gagggcattgacagtgagattggccccttcatcaagcttagtgaccctggcatcccagtc
tctgtgctgaccaggcaagagtgcatcgagcggatcccctggatcgctcctgagtgtgtt
gaagactccaagaacctgagtgtggctgctgacaaatggagctttggaaccacactctgg
gaaatctgctacaatggcgagatccccctcaaagacaagaccctggttgagaaggagaga
ttttatgaaagccgctgcaggccagtgactccatcttgcaaggagctagctgaccttatg
actcgctgcatgaactatgaccccaatcagaggcccttcttccgagccatcatgagggac
attaacaagctggaagagcagaatccagacattgtttcagaaaagcagccaacaacagag
gtggatcccacccattttgaaaaacgtttcctgaagaggatccgtgacttgggagagggt
cactttgggaaggtggaactctgtagatatgatcctgagggagacaacacaggggaacaa
gtggctgtcaagtccctgaagcctgagagtggaggtaaccacatagctgacctgaagaag
gagatagagatcttgcggaacctctaccacgagaacattgtcaagtacaaaggaatctgc
atggaagacggagggaatggcatcaagctcatcatggaatttctgccttcgggaagccta
aaggagtatctgccaaagaataagaacaaaattaacctcaaacaacagctaaaatatgcc
atacagatttgtaaggggatggactatttgggttctcgacagtatgttcaccgagactta
gcagcaagaaatgtccttgttgagagtgaacaccaagtgaagatcggagactttggttta
accaaagcaattgaaactgacaaggagtactacacagtcaaggatgaccgagacagccca
gtgttttggtacgctccggaatgtttaatccagtgtaagttttacatcgcctctgatgtc
tggtcttttggagtgaccctgcacgagctgctcacctactgtgactcagactttagtccc
atgactttgttcctgaaaatgataggcccaactcatggccagatgacagtaactcggctt
gtgaatactctgaaagaaggaaagcgcttgccctgtccacccaactgtcctgaagaggtt
tatcagcttatgagaaaatgctgggaattccaaccatctaatcggacaacctttcagaac
ctcatcgaaggatttgaagcacttttaaaataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110555765
Entry
110555765         CDS       T05884                                 

Gene name
Tyk2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun05145  Toxoplasmosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110555765 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110555765 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110555765 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    110555765 (Tyk2)
   04659 Th17 cell differentiation
    110555765 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110555765 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110555765 (Tyk2)
   05160 Hepatitis C
    110555765 (Tyk2)
   05171 Coronavirus disease - COVID-19
    110555765 (Tyk2)
   05164 Influenza A
    110555765 (Tyk2)
   05162 Measles
    110555765 (Tyk2)
   05168 Herpes simplex virus 1 infection
    110555765 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110555765 (Tyk2)
   05169 Epstein-Barr virus infection
    110555765 (Tyk2)
   05165 Human papillomavirus infection
    110555765 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110555765 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110555765 (Tyk2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110555765 (Tyk2)
Protein kinases [BR:mun01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110555765 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 110555765
NCBI-ProteinID: XP_021504861
LinkDB
Position
Unknown
AA seq 1182 aa
MPLCRRRATQEENKADGTEAQPMVPTESLTVLLHWAGPEGGEPWVTFSQASLTAEEACIH
IAHKVGITPPCLNLFALYDAQAKVWLPPNHILDTSRDVSLKLYFRMRFYFRNWHGMTPQE
PAVYRCGFPGAEASSERAEQGVQLLDSASFEYLFEQGKHEFMNDVVSLRDLSNEEEIHHF
KNESLGMAFLHLCHLALCRGIPLEEMAREISFKNCIPRSFREHIRQHNVLTRLRLRRVFR
RFLQAFQPGHLSQQVVMVKYLATLERLAPRFGSEHIPVCQLEVVDQPERDPCYLQNSGQT
SGDSGPELAPGPPTHEVLVTGTGGIQWRPLPRQESERSHNVGNPQGTRSGKKAKAPEAGE
QLAESPGEPAWTYFCDFQDISHVVLKDRHVRIHLQDNKCLLLRLCSRAEALSFVALVDGY
FRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDPFAQAKLWPEDGLYLIQWSTSHLHRL
ILTVAHRNPAPSSGPRGLRLRKFPITQQPGAFVLEGWGRSFDTIGDLRVALQGCSLRAGD
DCFPLHRCCLPRPGEISNLLIMRGSSAHTRPLNLSQLSFHRVHQDEITQLSHLGQGTRTN
VYEGLLRVGGPDEGKADSGCPPEPGGNGEQQLRVVLKVLDPSHHGIALAFYETASLMSQV
SHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLRRQRGRLSMTWKMAVAQQLASALSYL
EDKNLVHGNVCGRNILLARLGLEEGTSPFIKLSDPGVGQAALSREERVERIPWTAPECLS
GGSSSLGTATDMWGFGATLLEICFDGEAPLQGRSPSEKERFYTKQHQLPEPSCPELATLT
RQCLTYEPGQRPSFRTILRDLTRLQPQNLVGVSAMNSDSPASDPTVFHKRYLKKIRDLGE
GHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGC
CEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDLA
ARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVW
SFGVTLYELLTYCDSSQSPPTKFIELIGVTQGQMTVLRLTELLERGERLPRPDRCPCEIY
LLMKNCWESEAPFRPTFQNLVPILKTAQEKYQGQVPSVFSVC
NT seq 3549 nt   +upstreamnt  +downstreamnt
atgcctctgtgtcggcggagagccacccaggaagagaacaaagcggatggcacagaagct
cagcccatggtgcccacagaaagcctgacggtgctgctgcactgggcaggccctgagggc
ggggagccctgggtcaccttcagccaggcatccctgactgccgaggaggcctgcatccac
attgcacacaaagtcggcatcactccaccctgcttgaatctctttgccctctatgatgca
caggccaaggtctggctgcccccaaaccatatcctggacacatcccgagatgtaagccta
aagctatatttccgcatgaggttttacttccggaactggcatggcatgactccccaggaa
ccggctgtgtaccggtgcggtttcccaggggcagaggcttcctcagaacgggcagagcag
ggcgtgcagctcttggattctgcctcatttgaatacctttttgagcagggaaaacatgag
ttcatgaatgatgtagtctctctgcgggacctgtcaaacgaggaagagatccaccacttt
aagaatgagagcctgggcatggcctttctgcatctctgccaccttgctctctgccgtggt
atccccctggaggaaatggccagagagatcagcttcaagaactgcatccctcgctccttc
cgagagcacatccgtcagcacaacgtgctcacgcgcctgcgcctccgaagagtcttccgc
cgattcctgcaggccttccagcctggccacctctcccagcaggtggtgatggttaagtac
ctggccaccctggagcggctggctccccgctttggctcagagcacatccctgtgtgtcag
ctggaggtagtggatcagcctgagagggacccctgctacctccaaaacagtgggcagact
tccggggactcaggcccagagctggcccccgggcctcccacccacgaggtgctggtgaca
ggcaccggaggtatccagtggcggccactgccgaggcaggaatctgagagaagccacaac
gtagggaatccccagggcacccggtctgggaagaaggccaaggcccctgaggccggagag
cagctggcagagagtcctggggagccagcctggacctacttctgtgacttccaggacatc
tcccacgtggtgctgaaggaccgccacgtgcgcatccaccttcaggacaacaagtgcttg
ttgctgcgcctctgctcccgggctgaggccctgtcctttgtggccctggtggatggctat
ttccgattgaccgctgactccagccactacctgtgccatgaggtggcgcccccgaggctg
gtgaccagcatccagaatggcatccacgggcccctgatggatccatttgcgcaggccaag
ctctggccggaagatggcctctacctgattcagtggagcaccagccacctgcaccgcctg
atcctcactgtggcccatcgaaacccggctcccagtagtggcccgaggggcctgcgcctc
cgaaaattccccatcacccagcagcccggagcctttgtgctggaaggctggggacgctcc
tttgacaccataggggaccttcgggtggccttgcagggctgctcacttcgggctggcgac
gactgtttccccttgcaccgctgttgcctgccccggccaggagaaatctccaacctcctg
atcatgcgggggtccagcgcccacacccgcccgctcaacctcagtcagctcagcttccac
agggttcaccaggatgaaatcacccagctgtcccacctgggccaaggcacaaggaccaat
gtgtatgagggcctgctacgagtggggggccctgatgaaggcaaagcagacagtggctgc
ccccctgagcctggtgggaacggtgagcagcagcttcgagtggtgcttaaagtcctggac
cccagccaccatggcatcgccttggccttctacgaaacagctagcctcatgagccaggtg
tcacacatgcacctggccttcctgcacggggtgtgcgtgcgaggctcagagaatatcatt
gtgacagagttcgtggaacatggtcccctggatgtgtggttacggcgacagcggggccga
ctctccatgacctggaagatggctgtggcccagcagctggccagcgccctcagctacctg
gaggacaagaatctggttcatgggaatgtatgtggccggaacatcctgctggcccggctg
gggctggaggagggcaccagccccttcatcaagctaagtgatcctggtgtgggccaagcc
gccctctccagggaggagcgggtggagcgtattccctggacagctcctgagtgcctgtct
ggaggatccagtagcttgggtactgccacagacatgtggggcttcggtgccaccctcctt
gagatctgctttgatggagaggcacccctgcagggccgtagcccctctgagaaagaacga
ttctacacaaagcagcaccagctgcctgagccctcgtgcccagagctggccacgctcacc
cgccagtgcctcacctatgaaccaggacagcggccatcattccgcaccatcttgagggac
ctcactagactgcagccacagaatcttgtgggtgtttcggccatgaactcagactcacca
gcatcagaccccactgttttccacaagcggtacttgaagaagatccgggatctgggtgag
ggtcattttggtaaggtcagcctgtactgctacgacccaaccaacgatggaactggcgag
atggtggccgtgaaagcccttaaggagggatgtggtccccagctccgctcaggctggcag
cgggagatcgaaatcctacgaacgctgtaccatgaacacattgtcaagtacaaaggctgc
tgtgaggaccaaggagagaagtctgtacagctggtcatggaatacgtccctctgggcagc
ctacgagattacctgccccggcacagcgtagggctggctcagctcctgctgttcgcccag
cagatctgcgagggcatggcttacctgcatgcgcagcactacattcaccgagacttggcc
gcgcgcaacgtgctgctggacaacgacaggctggtcaagattggggactttggcctagcc
aaggctgtgccggaaggccacgagtactaccgcgtgcgcgaggacggggacagcccggtg
ttctggtatgccccggaatgcctgaaggagtgcaaattttactatgcatctgatgtctgg
tcctttggggtgaccctgtatgagctgttgacatactgtgactctagccagagtcccccc
acgaaattcatcgagctcatcggcgtcacccaaggccagatgaccgtgctaaggctcaca
gagctgttggaacgaggagagaggctgccgcggcctgacagatgtccctgtgagatctat
ctcctcatgaagaactgctgggagtcagaagctcccttccggcccaccttccagaatctg
gtgcccatcctcaagacagcccaggagaagtatcaaggccaggtgccgtcagtgttcagc
gtctgctga

DBGET integrated database retrieval system