KEGG   Meriones unguiculatus (Mongolian gerbil): 110556519
Entry
110556519         CDS       T05884                                 

Gene name
Irf9
Definition
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04621  NOD-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110556519 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110556519 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110556519 (Irf9)
   04625 C-type lectin receptor signaling pathway
    110556519 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110556519 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110556519 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110556519 (Irf9)
   05171 Coronavirus disease - COVID-19
    110556519 (Irf9)
   05164 Influenza A
    110556519 (Irf9)
   05162 Measles
    110556519 (Irf9)
   05168 Herpes simplex virus 1 infection
    110556519 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110556519 (Irf9)
   05169 Epstein-Barr virus infection
    110556519 (Irf9)
   05165 Human papillomavirus infection
    110556519 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110556519 (Irf9)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110556519 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF SR-25
Other DBs
NCBI-GeneID: 110556519
NCBI-ProteinID: XP_021505999
LinkDB
Position
Unknown
AA seq 405 aa
MASGKARCTRKLRSWIVAQVESGQFPGVCWDDEAKTMFRIPWKHAGKQDFREEDAAIFKA
WAEFKQKHKGGDIGNPAVWKTRLRCALNKSPEFEEVPLRGRMDVAEPYKVYRILPPGTLP
AQPRAQKSSKRRLSSESPEREESKEKGRTNGTVSHSDSDSCDAGSSGNSCSSSSSSSFGS
NSGGTSPELEEAGARTTEDTMQDDSVFLEQQLSENSDFSLRLTFIYSGRVVSEVQVNSLD
CRLVADPSFSDRTMLQVLFPKPDPPEPTQHLLSQLERGLLVASNSRGLFVQRLCPIPISW
NAPEAPPGPGPHLLPNNKCVVLFKTTSFCRDLAQYCQGQGPPPKFQATLHFWEQSPGSSQ
TQENLITVQMEQAFARPLLEKIPEEQRATLFLVQNPAQPLGVLAL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcctcgggcaaagcacgctgtacccgaaagctccggagctggatagtggcgcaggtg
gagagcgggcagttcccgggggtgtgctgggacgatgaagccaagaccatgttccggatt
ccctggaagcacgcaggcaagcaagacttccgagaggaggacgctgccatattcaaggct
tgggcagagtttaagcagaagcacaaggggggggacataggcaaccctgccgtctggaag
actcgtctgcgctgtgccctcaacaagagtcctgaatttgaggaggttcccctcagaggc
cgcatggatgtcgccgaaccgtacaaagtctatcggatactgccaccaggaaccctccct
gcccaaccaagagcccagaaatcatcaaagcgacgtctcagttccgagtcacctgagagg
gaagagagcaaggagaaggggagaaccaatgggactgtgagccactcagacagcgacagt
tgcgacgccggcagcagtggaaacagctgcagcagtagcagcagcagcagcttcggcagc
aacagcggtggcactagccctgagctggaggaagcaggtgcccgcacaactgaagacacc
atgcaggatgactcagtgttcttggagcagcagctttctgagaactcagacttctctctg
cggctcaccttcatctacagtgggcgtgtggtgagcgaggtccaggtgaacagcctcgac
tgccggctggtggctgatccctcattctcggacagaaccatgctgcaggtgctgtttccc
aaacctgacccaccagagcctacccagcacctgctcagtcagcttgagagaggcctcctg
gtggccagcaattccagaggcctcttcgttcaacgcctttgccccatccccatctcctgg
aatgcacctgaggccccgcctgggcctgggcctcacctgctgcccaacaacaagtgtgtg
gtgctcttcaagaccacctccttctgtagagacttggcgcagtactgccagggccagggc
ccaccccccaagttccaggcaacactgcatttctgggagcagagccctggctccagccag
acccaagaaaatctcatcacagtgcagatggagcaggcctttgcccgacctttactggag
aagattccagaggagcagagagccaccttgttcctggtccagaacccagcacagccactt
ggtgtgttagcactgtga

DBGET integrated database retrieval system