KEGG   Meriones unguiculatus (Mongolian gerbil): 110556719
Entry
110556719         CDS       T05884                                 

Gene name
Akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04371  Apelin signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04728  Dopaminergic synapse
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04920  Adipocytokine signaling pathway
mun04922  Glucagon signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110556719 (Akt2)
   04012 ErbB signaling pathway
    110556719 (Akt2)
   04014 Ras signaling pathway
    110556719 (Akt2)
   04015 Rap1 signaling pathway
    110556719 (Akt2)
   04370 VEGF signaling pathway
    110556719 (Akt2)
   04371 Apelin signaling pathway
    110556719 (Akt2)
   04630 JAK-STAT signaling pathway
    110556719 (Akt2)
   04668 TNF signaling pathway
    110556719 (Akt2)
   04066 HIF-1 signaling pathway
    110556719 (Akt2)
   04068 FoxO signaling pathway
    110556719 (Akt2)
   04072 Phospholipase D signaling pathway
    110556719 (Akt2)
   04071 Sphingolipid signaling pathway
    110556719 (Akt2)
   04024 cAMP signaling pathway
    110556719 (Akt2)
   04022 cGMP-PKG signaling pathway
    110556719 (Akt2)
   04151 PI3K-Akt signaling pathway
    110556719 (Akt2)
   04152 AMPK signaling pathway
    110556719 (Akt2)
   04150 mTOR signaling pathway
    110556719 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110556719 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    110556719 (Akt2)
   04218 Cellular senescence
    110556719 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110556719 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110556719 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110556719 (Akt2)
   04613 Neutrophil extracellular trap formation
    110556719 (Akt2)
   04620 Toll-like receptor signaling pathway
    110556719 (Akt2)
   04625 C-type lectin receptor signaling pathway
    110556719 (Akt2)
   04660 T cell receptor signaling pathway
    110556719 (Akt2)
   04662 B cell receptor signaling pathway
    110556719 (Akt2)
   04664 Fc epsilon RI signaling pathway
    110556719 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    110556719 (Akt2)
   04062 Chemokine signaling pathway
    110556719 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110556719 (Akt2)
   04922 Glucagon signaling pathway
    110556719 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    110556719 (Akt2)
   04920 Adipocytokine signaling pathway
    110556719 (Akt2)
   04929 GnRH secretion
    110556719 (Akt2)
   04915 Estrogen signaling pathway
    110556719 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    110556719 (Akt2)
   04917 Prolactin signaling pathway
    110556719 (Akt2)
   04926 Relaxin signaling pathway
    110556719 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    110556719 (Akt2)
   04919 Thyroid hormone signaling pathway
    110556719 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110556719 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110556719 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    110556719 (Akt2)
   04728 Dopaminergic synapse
    110556719 (Akt2)
   04722 Neurotrophin signaling pathway
    110556719 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110556719 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    110556719 (Akt2)
   04213 Longevity regulating pathway - multiple species
    110556719 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556719 (Akt2)
   05205 Proteoglycans in cancer
    110556719 (Akt2)
   05230 Central carbon metabolism in cancer
    110556719 (Akt2)
   05231 Choline metabolism in cancer
    110556719 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110556719 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110556719 (Akt2)
   05212 Pancreatic cancer
    110556719 (Akt2)
   05225 Hepatocellular carcinoma
    110556719 (Akt2)
   05226 Gastric cancer
    110556719 (Akt2)
   05214 Glioma
    110556719 (Akt2)
   05221 Acute myeloid leukemia
    110556719 (Akt2)
   05220 Chronic myeloid leukemia
    110556719 (Akt2)
   05218 Melanoma
    110556719 (Akt2)
   05211 Renal cell carcinoma
    110556719 (Akt2)
   05215 Prostate cancer
    110556719 (Akt2)
   05213 Endometrial cancer
    110556719 (Akt2)
   05224 Breast cancer
    110556719 (Akt2)
   05222 Small cell lung cancer
    110556719 (Akt2)
   05223 Non-small cell lung cancer
    110556719 (Akt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110556719 (Akt2)
   05017 Spinocerebellar ataxia
    110556719 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110556719 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110556719 (Akt2)
   04931 Insulin resistance
    110556719 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110556719 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110556719 (Akt2)
   05135 Yersinia infection
    110556719 (Akt2)
   05152 Tuberculosis
    110556719 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110556719 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    110556719 (Akt2)
   05161 Hepatitis B
    110556719 (Akt2)
   05160 Hepatitis C
    110556719 (Akt2)
   05164 Influenza A
    110556719 (Akt2)
   05162 Measles
    110556719 (Akt2)
   05168 Herpes simplex virus 1 infection
    110556719 (Akt2)
   05163 Human cytomegalovirus infection
    110556719 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110556719 (Akt2)
   05169 Epstein-Barr virus infection
    110556719 (Akt2)
   05165 Human papillomavirus infection
    110556719 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110556719 (Akt2)
   05142 Chagas disease
    110556719 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110556719 (Akt2)
   01524 Platinum drug resistance
    110556719 (Akt2)
   01522 Endocrine resistance
    110556719 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110556719 (Akt2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110556719 (Akt2)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110556719 (Akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 110556719
NCBI-ProteinID: XP_021506284
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQQGPGEDAM
EYKCGSPSDSSTSEMMEVAVNKARAKVTMSDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaggaaggctggcttcacaagcgtggtgaatacatcaaa
acttggaggccccggtacttccttctgaagagtgatggatctttcattgggtataaggag
aggcccgaggcccctgaccagaccttaccccccctcaacaatttctctgtagcagagtgc
cagctgatgaagacagagaggccgcggcccaacacctttgtcatccgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggactctccggatgagagggaagagtggatg
cgggctatccagatggtcgccaacagtctgaagcagcagggccctggtgaggatgccatg
gagtacaagtgtggctcccccagtgactcttccacgtctgagatgatggaggtggctgtt
aacaaggcccgggccaaagtgaccatgagcgacttcgactatctcaaactcctcggcaag
ggcaccttcggcaaagtcatcctagtgcgggagaaggccacaggccgctattatgccatg
aagatcctacggaaggaggtcatcattgccaaggatgaagtcgcccacacggtcactgag
agccgagtcctgcagaataccaggcaccccttccttactgccctgaagtatgccttccag
acgcatgaccgcctgtgcttcgtgatggagtacgccaacgggggcgagctcttcttccac
ctgtctcgggagcgagtcttcactgaggaccgggcgcgcttctacggtgcagagatagtg
tcggccctcgagtatttacactcaagggatgtggtgtaccgtgacatcaagctggaaaat
ctcatgctggacaaggatggccacatcaagatcactgactttggcttatgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtggtaccccggagtacttggctcctgag
gtgctggaggacaatgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctgttcgag
ctcatcctcatggaggagatccgctttccacgcacgctcggcccggaggccaagtccctg
ctggctgggctgctcaagaaggaccccaagcagaggcttggtggaggtcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaattggcaggatgtggtacagaaa
aagctcctgccacccttcaaacctcaggtcacttccgaagtagacacaaggtactttgat
gacgagttcacggcccagtccatcacaatcacacccccagaccgctatgacagcctgggc
tcgctggagctggaccagcggacgcacttcccccagttctcctactcagccagcatccgt
gagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110558966
Entry
110558966         CDS       T05884                                 

Gene name
Akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04371  Apelin signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04728  Dopaminergic synapse
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04920  Adipocytokine signaling pathway
mun04922  Glucagon signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110558966 (Akt1)
   04012 ErbB signaling pathway
    110558966 (Akt1)
   04014 Ras signaling pathway
    110558966 (Akt1)
   04015 Rap1 signaling pathway
    110558966 (Akt1)
   04370 VEGF signaling pathway
    110558966 (Akt1)
   04371 Apelin signaling pathway
    110558966 (Akt1)
   04630 JAK-STAT signaling pathway
    110558966 (Akt1)
   04668 TNF signaling pathway
    110558966 (Akt1)
   04066 HIF-1 signaling pathway
    110558966 (Akt1)
   04068 FoxO signaling pathway
    110558966 (Akt1)
   04072 Phospholipase D signaling pathway
    110558966 (Akt1)
   04071 Sphingolipid signaling pathway
    110558966 (Akt1)
   04024 cAMP signaling pathway
    110558966 (Akt1)
   04022 cGMP-PKG signaling pathway
    110558966 (Akt1)
   04151 PI3K-Akt signaling pathway
    110558966 (Akt1)
   04152 AMPK signaling pathway
    110558966 (Akt1)
   04150 mTOR signaling pathway
    110558966 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110558966 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    110558966 (Akt1)
   04218 Cellular senescence
    110558966 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110558966 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110558966 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110558966 (Akt1)
   04613 Neutrophil extracellular trap formation
    110558966 (Akt1)
   04620 Toll-like receptor signaling pathway
    110558966 (Akt1)
   04625 C-type lectin receptor signaling pathway
    110558966 (Akt1)
   04660 T cell receptor signaling pathway
    110558966 (Akt1)
   04662 B cell receptor signaling pathway
    110558966 (Akt1)
   04664 Fc epsilon RI signaling pathway
    110558966 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    110558966 (Akt1)
   04062 Chemokine signaling pathway
    110558966 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110558966 (Akt1)
   04922 Glucagon signaling pathway
    110558966 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    110558966 (Akt1)
   04920 Adipocytokine signaling pathway
    110558966 (Akt1)
   04929 GnRH secretion
    110558966 (Akt1)
   04915 Estrogen signaling pathway
    110558966 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    110558966 (Akt1)
   04917 Prolactin signaling pathway
    110558966 (Akt1)
   04926 Relaxin signaling pathway
    110558966 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    110558966 (Akt1)
   04919 Thyroid hormone signaling pathway
    110558966 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110558966 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110558966 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    110558966 (Akt1)
   04728 Dopaminergic synapse
    110558966 (Akt1)
   04722 Neurotrophin signaling pathway
    110558966 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110558966 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    110558966 (Akt1)
   04213 Longevity regulating pathway - multiple species
    110558966 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110558966 (Akt1)
   05205 Proteoglycans in cancer
    110558966 (Akt1)
   05230 Central carbon metabolism in cancer
    110558966 (Akt1)
   05231 Choline metabolism in cancer
    110558966 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110558966 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110558966 (Akt1)
   05212 Pancreatic cancer
    110558966 (Akt1)
   05225 Hepatocellular carcinoma
    110558966 (Akt1)
   05226 Gastric cancer
    110558966 (Akt1)
   05214 Glioma
    110558966 (Akt1)
   05221 Acute myeloid leukemia
    110558966 (Akt1)
   05220 Chronic myeloid leukemia
    110558966 (Akt1)
   05218 Melanoma
    110558966 (Akt1)
   05211 Renal cell carcinoma
    110558966 (Akt1)
   05215 Prostate cancer
    110558966 (Akt1)
   05213 Endometrial cancer
    110558966 (Akt1)
   05224 Breast cancer
    110558966 (Akt1)
   05222 Small cell lung cancer
    110558966 (Akt1)
   05223 Non-small cell lung cancer
    110558966 (Akt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110558966 (Akt1)
   05017 Spinocerebellar ataxia
    110558966 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110558966 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110558966 (Akt1)
   04931 Insulin resistance
    110558966 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110558966 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110558966 (Akt1)
   05135 Yersinia infection
    110558966 (Akt1)
   05152 Tuberculosis
    110558966 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110558966 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    110558966 (Akt1)
   05161 Hepatitis B
    110558966 (Akt1)
   05160 Hepatitis C
    110558966 (Akt1)
   05164 Influenza A
    110558966 (Akt1)
   05162 Measles
    110558966 (Akt1)
   05168 Herpes simplex virus 1 infection
    110558966 (Akt1)
   05163 Human cytomegalovirus infection
    110558966 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110558966 (Akt1)
   05169 Epstein-Barr virus infection
    110558966 (Akt1)
   05165 Human papillomavirus infection
    110558966 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110558966 (Akt1)
   05142 Chagas disease
    110558966 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110558966 (Akt1)
   01524 Platinum drug resistance
    110558966 (Akt1)
   01522 Endocrine resistance
    110558966 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110558966 (Akt1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110558966 (Akt1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110558966 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110558966
NCBI-ProteinID: XP_021509836
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LNPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtagccattgtgaaggagggctggctgcacaaacgaggggaatacattaaa
acctggcggccacgctacttcctcctcaagaatgatggcacctttatcggctacaaggaa
cggcctcaggatgtggaacagcgcgagtcccccctcaacaacttctcagtggcacaatgc
cagctgatgaagacagaacggccaaggcccaacaccttcatcatccgctgcctgcagtgg
accacagtcattgagcgcaccttccatgtggaaacgcctgaagagcgggaagagtggacc
actgccatccagactgtggctgatggactcaagaggcaggaggaagagacgatggatttc
cgatcaggttcgcccagtgacaactcaggggctgaggagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaatgagttcgagtacctgaagctgttgggcaagggcacc
ttcgggaaggtgatcctggtgaaggagaaggctacaggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgttgccaaggacgaggttgcccacacgctgaccgagaaccgt
gtcctgcagaactctaggcaccccttcctcaccgccctgaagtactcattccagacccat
gatcgcctctgctttgtcatggaatatgccaacgggggcgagctcttcttccatctgtct
cgtgagcgtgtgttttctgaggaccgggcccgcttctatggcgcggagattgtgtcggcc
ctggactacctgcactctgagaagaacgtggtgtaccgggatcttaagctggagaacctc
atgctggacaaggacggacacatcaagataacagactttgggctgtgcaaggagggcatc
aaggatggcgccactatgaagaccttctgcggaacacctgagtaccttgcccctgaggtg
ctggaggacaatgattatggccgcgcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctgttcgagctc
atcctcatggaggaaatccgtttcccgcgcacgctcggcccagaggccaagtccctgctc
tctgggctgctcaagaaggaccccacccagaggcttggtgggggctccgaggatgccaag
gagatcatgcagcaccgcttctttgccaacatcgtgtggcaggatgtgtatgagaagaag
ctgaacccacccttcaagccccaggtcacctctgagactgacaccaggtattttgatgag
gagttcacagcccagatgatcaccatcacaccgcccgaccaagacgacagcatggagtgt
gtagacagcgagcggaggccgcactttccccagttttcctactcagccagtggcacagcc
tga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110564898
Entry
110564898         CDS       T05884                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04371  Apelin signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04728  Dopaminergic synapse
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04920  Adipocytokine signaling pathway
mun04922  Glucagon signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110564898
   04012 ErbB signaling pathway
    110564898
   04014 Ras signaling pathway
    110564898
   04015 Rap1 signaling pathway
    110564898
   04370 VEGF signaling pathway
    110564898
   04371 Apelin signaling pathway
    110564898
   04630 JAK-STAT signaling pathway
    110564898
   04668 TNF signaling pathway
    110564898
   04066 HIF-1 signaling pathway
    110564898
   04068 FoxO signaling pathway
    110564898
   04072 Phospholipase D signaling pathway
    110564898
   04071 Sphingolipid signaling pathway
    110564898
   04024 cAMP signaling pathway
    110564898
   04022 cGMP-PKG signaling pathway
    110564898
   04151 PI3K-Akt signaling pathway
    110564898
   04152 AMPK signaling pathway
    110564898
   04150 mTOR signaling pathway
    110564898
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110564898
  09143 Cell growth and death
   04210 Apoptosis
    110564898
   04218 Cellular senescence
    110564898
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110564898
   04550 Signaling pathways regulating pluripotency of stem cells
    110564898
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110564898
   04613 Neutrophil extracellular trap formation
    110564898
   04620 Toll-like receptor signaling pathway
    110564898
   04625 C-type lectin receptor signaling pathway
    110564898
   04660 T cell receptor signaling pathway
    110564898
   04662 B cell receptor signaling pathway
    110564898
   04664 Fc epsilon RI signaling pathway
    110564898
   04666 Fc gamma R-mediated phagocytosis
    110564898
   04062 Chemokine signaling pathway
    110564898
  09152 Endocrine system
   04910 Insulin signaling pathway
    110564898
   04922 Glucagon signaling pathway
    110564898
   04923 Regulation of lipolysis in adipocytes
    110564898
   04920 Adipocytokine signaling pathway
    110564898
   04929 GnRH secretion
    110564898
   04915 Estrogen signaling pathway
    110564898
   04914 Progesterone-mediated oocyte maturation
    110564898
   04917 Prolactin signaling pathway
    110564898
   04926 Relaxin signaling pathway
    110564898
   04935 Growth hormone synthesis, secretion and action
    110564898
   04919 Thyroid hormone signaling pathway
    110564898
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110564898
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110564898
  09156 Nervous system
   04725 Cholinergic synapse
    110564898
   04728 Dopaminergic synapse
    110564898
   04722 Neurotrophin signaling pathway
    110564898
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110564898
  09149 Aging
   04211 Longevity regulating pathway
    110564898
   04213 Longevity regulating pathway - multiple species
    110564898
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110564898
   05205 Proteoglycans in cancer
    110564898
   05230 Central carbon metabolism in cancer
    110564898
   05231 Choline metabolism in cancer
    110564898
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110564898
  09162 Cancer: specific types
   05210 Colorectal cancer
    110564898
   05212 Pancreatic cancer
    110564898
   05225 Hepatocellular carcinoma
    110564898
   05226 Gastric cancer
    110564898
   05214 Glioma
    110564898
   05221 Acute myeloid leukemia
    110564898
   05220 Chronic myeloid leukemia
    110564898
   05218 Melanoma
    110564898
   05211 Renal cell carcinoma
    110564898
   05215 Prostate cancer
    110564898
   05213 Endometrial cancer
    110564898
   05224 Breast cancer
    110564898
   05222 Small cell lung cancer
    110564898
   05223 Non-small cell lung cancer
    110564898
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110564898
   05017 Spinocerebellar ataxia
    110564898
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110564898
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110564898
   04931 Insulin resistance
    110564898
   04933 AGE-RAGE signaling pathway in diabetic complications
    110564898
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110564898
   05135 Yersinia infection
    110564898
   05152 Tuberculosis
    110564898
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110564898
   05170 Human immunodeficiency virus 1 infection
    110564898
   05161 Hepatitis B
    110564898
   05160 Hepatitis C
    110564898
   05164 Influenza A
    110564898
   05162 Measles
    110564898
   05168 Herpes simplex virus 1 infection
    110564898
   05163 Human cytomegalovirus infection
    110564898
   05167 Kaposi sarcoma-associated herpesvirus infection
    110564898
   05169 Epstein-Barr virus infection
    110564898
   05165 Human papillomavirus infection
    110564898
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110564898
   05142 Chagas disease
    110564898
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110564898
   01524 Platinum drug resistance
    110564898
   01522 Endocrine resistance
    110564898
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110564898
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110564898
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110564898
SSDB
Motif
Pfam: Pkinase PH PK_Tyr_Ser-Thr FTA2 PH_11
Other DBs
NCBI-GeneID: 110564898
NCBI-ProteinID: XP_021518120
LinkDB
Position
Unknown
AA seq 274 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaggaaggttgggttcagaagaggggggaatacataaaa
aattggaggccaagatacttcctattgaagacagatggctcattcataggctacaaagag
aaacctcaagatgtggacttaccgtatcccctcaacaacttttcagtggcgaaatgccag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacattccatgtagatacaccagaggaaagagaagaatggacagaa
gctatccaggctgtagcagaccgactgcagagacaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcatctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaagctactaggtaaaggcacctttggg
aaggttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacacgcttactgaaagcagagtacta
aagaataccagacatccattcttaacatccttgaaatattccttccagacaaaagaccgt
ctgtgttttgtgatggaatatgttaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaaggta

DBGET integrated database retrieval system