KEGG   Meriones unguiculatus (Mongolian gerbil): 110556771
Entry
110556771         CDS       T05884                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04066  HIF-1 signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04630  JAK-STAT signaling pathway
mun04640  Hematopoietic cell lineage
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110556771 (Epo)
   04066 HIF-1 signaling pathway
    110556771 (Epo)
   04151 PI3K-Akt signaling pathway
    110556771 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110556771 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110556771 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556771 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110556771 (Epo)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  CSF and other factors
   110556771 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110556771
NCBI-ProteinID: XP_021506382
LinkDB
Position
Unknown
AA seq 220 aa
MEAARADPEPRAAAPVGGPARLPLAQPAFLPESPTLLPLLPLLLLLPLGRPALGAAPRLI
CDSRLLERYILEAKEAENATNGCAEGPRLSENITVPDTKVNFYVWKRMEVEEQAAEVWQG
LSLLSEAVVRGQALLANSSQAPQPLQLHVDRAVSGLRSLAALLRVLGAQQEAESAPEASP
LPPLRTLSADSFCKLFRVYANFLRGKLKLYAGEACRRAAR
NT seq 663 nt   +upstreamnt  +downstreamnt
atggaggccgcgcgggccgacccggagccgcgggcagccgcgccggtgggcggcccagcc
cgcctccccctcgctcagcccgccttccttccagaaagtcccaccctgctgccgctgctg
ccgctgctgctgctgctgccgctgggccgcccggcgctcggcgctgccccgcgcctcatc
tgcgacagccgactgctggagaggtacatcctggaggccaaggaggccgagaacgccacg
aacggttgtgcagaaggtcccagactaagtgagaacattacagtcccggacaccaaagtc
aacttctacgtttggaaaagaatggaggtggaggagcaggctgcagaagtgtggcagggc
ctgtccctgctgtcagaggccgtggtgcggggacaggccctgctggccaactcctcgcag
gcgccgcagcccctgcagctgcacgtggacagagcggtgagcggcctgcgcagcctcgct
gccctgctccgagtgctgggcgcccagcaggaagcggagtcagcccccgaggccagcccg
ctgcccccgctccgaacgctctctgcggattctttctgcaaactcttccgggtctacgcc
aacttcctccgggggaagctgaagttgtacgcgggggaggcctgccggagagcggccagg
tga

DBGET integrated database retrieval system