KEGG   Meriones unguiculatus (Mongolian gerbil): 110556827
Entry
110556827         CDS       T05884                                 

Gene name
Faslg
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6 isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04217  Necroptosis
mun04650  Natural killer cell mediated cytotoxicity
mun04722  Neurotrophin signaling pathway
mun04932  Non-alcoholic fatty liver disease
mun04940  Type I diabetes mellitus
mun05022  Pathways of neurodegeneration - multiple diseases
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05168  Herpes simplex virus 1 infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05320  Autoimmune thyroid disease
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110556827 (Faslg)
   04014 Ras signaling pathway
    110556827 (Faslg)
   04068 FoxO signaling pathway
    110556827 (Faslg)
   04151 PI3K-Akt signaling pathway
    110556827 (Faslg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110556827 (Faslg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110556827 (Faslg)
   04217 Necroptosis
    110556827 (Faslg)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110556827 (Faslg)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110556827 (Faslg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556827 (Faslg)
   05205 Proteoglycans in cancer
    110556827 (Faslg)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110556827 (Faslg)
   05330 Allograft rejection
    110556827 (Faslg)
   05332 Graft-versus-host disease
    110556827 (Faslg)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    110556827 (Faslg)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110556827 (Faslg)
   04932 Non-alcoholic fatty liver disease
    110556827 (Faslg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110556827 (Faslg)
   05161 Hepatitis B
    110556827 (Faslg)
   05160 Hepatitis C
    110556827 (Faslg)
   05164 Influenza A
    110556827 (Faslg)
   05162 Measles
    110556827 (Faslg)
   05168 Herpes simplex virus 1 infection
    110556827 (Faslg)
   05163 Human cytomegalovirus infection
    110556827 (Faslg)
   05165 Human papillomavirus infection
    110556827 (Faslg)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110556827 (Faslg)
   05143 African trypanosomiasis
    110556827 (Faslg)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110556827 (Faslg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110556827 (Faslg)
   04052 Cytokines and growth factors [BR:mun04052]
    110556827 (Faslg)
   04090 CD molecules [BR:mun04090]
    110556827 (Faslg)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110556827 (Faslg)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Tumor necrosis fators
   110556827 (Faslg)
CD molecules [BR:mun04090]
 Proteins
  110556827 (Faslg)
SSDB
Motif
Pfam: TNF PRIMA1
Other DBs
NCBI-GeneID: 110556827
NCBI-ProteinID: XP_021506460
LinkDB
Position
Unknown
AA seq 279 aa
MQQPVNYPSPQIYWVDNSATSPWAPPESVLTCPSSVPGRPDQRRLPPPPPPLPPPSQPPP
PPLPLLTPLQKKRNHNTELWLPVIFFMVMVALVGLALGMYQLFHLQKELAELREFTNQSL
KVSPFEKQIGHPSPPSEKKEPRCVAHLTGNPHSSSASLEWEDTYGTALISGVKYKKGGLL
ISDAGLYFVYSKVYFRGQSCNSQPLKHKVYTRNSKYPGDLVLMEEKNLNYCATGQIWAHS
SYLGAIFNLTSADHLYVNVSHLSLINFEESKTFFGLYKL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcagcagcctgtgaattacccaagtccacaaatctactgggtggacaacagtgccact
tctccttgggctcctccagagtcagttttaacctgtccgtcctctgtgcctggaaggcca
gaccaaaggagactaccaccacctccgccaccactaccacctccatcacaaccaccccca
cccccactgccactactaacccctctacagaagaagaggaaccacaacacagaactgtgg
ctaccggtgatctttttcatggttatggtggctctggttggattggcattaggaatgtat
cagctcttccatctgcagaaggagctggcagaactccgtgagttcaccaaccaaagcctt
aaagtatcacctttcgaaaagcaaataggccaccccagtccaccctctgaaaaaaaagag
ccgaggtgtgtggcccacttaacaggaaacccccactcaagttctgcctctctggaatgg
gaagacacatatggaacggctctgatctcgggagtgaagtataagaaaggtggccttctg
atcagcgatgctgggctgtactttgtatattccaaagtatacttccggggtcagtcttgc
aacagccagcccctaaaacacaaggtctacacgaggaactccaagtatcccggggatctg
gtgctaatggaggagaagaatttgaactactgcgctactggccagatatgggcccacagc
agctacctgggggcaatattcaatcttaccagtgctgaccatttatatgtcaatgtctct
catctctctctgattaattttgaggagtcaaagactttttttggcttatataagctttaa

DBGET integrated database retrieval system