KEGG   Meriones unguiculatus (Mongolian gerbil): 110557323
Entry
110557323         CDS       T05884                                 

Gene name
Arrb2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04062  Chemokine signaling pathway
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04728  Dopaminergic synapse
mun04740  Olfactory transduction
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04929  GnRH secretion
mun05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110557323 (Arrb2)
   04340 Hedgehog signaling pathway
    110557323 (Arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110557323 (Arrb2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110557323 (Arrb2)
  09152 Endocrine system
   04929 GnRH secretion
    110557323 (Arrb2)
   04926 Relaxin signaling pathway
    110557323 (Arrb2)
   04928 Parathyroid hormone synthesis, secretion and action
    110557323 (Arrb2)
  09156 Nervous system
   04728 Dopaminergic synapse
    110557323 (Arrb2)
  09157 Sensory system
   04740 Olfactory transduction
    110557323 (Arrb2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110557323 (Arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110557323 (Arrb2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    110557323 (Arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 110557323
NCBI-ProteinID: XP_021507287
LinkDB
Position
Unknown
AA seq 421 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDRVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFAATYQAFPPMPNPPRPPTRLQERLLRKLGRHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLIIRKVQFAPETPG
PQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLSVNVHVTNNSAKTVKKIRVSVRQY
ADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTVTPLLSDNQEKRGLALDGQLKHEDT
NLASSTIVKEGATKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQ
SVPVHPPPLCPSAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDEDCDEQF
C
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggagaaaaacccgggaccagggtcttcaagaagtcaagccctaactgcaagctcacc
gtgtacctgggcaagcgcgacttcgtggatcacctggacagagtggatcccgtggatggc
gtggtgctcgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgggaggacctggacgtgctgggcctgtctttccgcaaagatctg
ttcgccgccacctaccaggcctttccccccatgcccaacccgccccggccccccacccgc
ctgcaggagcggctgctcaggaagctgggccggcacgcccaccccttcttttttacgata
ccccagaacctgccctgctctgtcacgctgcagccgggtccggaggacacggggaaggcc
tgtggagtagattttgagattcgagccttctgtgccaaatcactagaagaaaaaagccac
aaaaggaactctgtgcgcctcatcatcagaaaggtccagtttgctccagagacgcccggc
ccccagccctccgctgagaccacgcgccacttcctcatgtccgaccggaggtccctgcac
ctagaggcgtccctggacaaagagctgtactaccacggggagcccctcagtgtcaacgtc
catgtcaccaacaattccgccaagaccgtcaagaagatcagagtctctgtgagacagtac
gctgacatctgcctcttcagcaccgcacagtacaagtgccctgtggctcagcttgaacaa
gatgaccaggtgtcccccagctccacgttctgcaaggtgtacactgtcaccccgctgctc
agtgacaaccaggagaagagaggcctggccctggatggccagctcaagcacgaagacacc
aacctggcctccagcaccatcgtgaaggagggggccaccaaggaggtgctgggcatcctg
gtgtcctacagggtcaaggtgaagctggtggtgtccagaggcggggatgtctccgtggag
ctgccttttgtcctcatgcaccccaagccccacgaccacatcacccttcccaggccccag
tcagtgcctgtccacccacccccgctctgcccttcagcgccccgggaaacagatgtccct
gtggataccaacctcatcgaattcgacaccaactatgccacagacgacgacatcgtgttt
gaggactttgcccggcttcggctgaaggggatgaaggatgaggactgtgacgagcagttt
tgctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560411
Entry
110560411         CDS       T05884                                 

Gene name
Arrb1
Definition
(RefSeq) beta-arrestin-1 isoform X1
  KO
K04439  beta-arrestin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04062  Chemokine signaling pathway
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04728  Dopaminergic synapse
mun04740  Olfactory transduction
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04929  GnRH secretion
mun05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110560411 (Arrb1)
   04340 Hedgehog signaling pathway
    110560411 (Arrb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110560411 (Arrb1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110560411 (Arrb1)
  09152 Endocrine system
   04929 GnRH secretion
    110560411 (Arrb1)
   04926 Relaxin signaling pathway
    110560411 (Arrb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110560411 (Arrb1)
  09156 Nervous system
   04728 Dopaminergic synapse
    110560411 (Arrb1)
  09157 Sensory system
   04740 Olfactory transduction
    110560411 (Arrb1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110560411 (Arrb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110560411 (Arrb1)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    110560411 (Arrb1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C LDB19 AP3B1_C SCA7 VPS28
Other DBs
NCBI-GeneID: 110560411
NCBI-ProteinID: XP_021511975
LinkDB
Position
Unknown
AA seq 430 aa
MASPFPALAPAHPACSSFPVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYL
KERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKL
GEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAESLEEKIHKRNSVRLVI
RKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTV
RKIKISVRQYADICLFNTAQYKCPVATEEADDTVAPSSTFCKVYTLTPFLANNREKRGLA
LDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKAKLVVARGGLLGDLASSDVAVELP
FTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGIKDDKDEEDD
GTGSPHLNNR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggcgtccccatttccagctctggccccagctcatcctgcctgctcatccttcccagtg
ttcaagaaggcaagccccaatggaaagctcactgtgtacctgggaaagcgggactttgtg
gaccacattgacctcgtggaccccgtggatggtgtggtcctcgtggatcctgagtatctc
aaagaaagacgagtctacgtgacgctgacctgcgccttccggtatggccgggaagacctg
gatgtcttgggtctgactttccgcaaagacctgtttgtggccaacgtgcagtccttcccg
ccggcccctgaggacaagaagccactcacgcgactccaagagaggctcatcaagaagctg
ggcgagcacgcctaccccttcacctttgagatccctccaaaccttccgtgctcggtgaca
ttgcagccagggccggaggacacagggaaggcctgcggtgtagactatgaagtcaaagcc
ttctgtgctgagagcctggaggagaagatccacaaaaggaattctgtgcggctggtcatc
cggaaggttcagtatgctccagagaggcctggccctcagcccacggctgagaccaccaga
cagttccttatgtcggacaagcctctgcaccttgaggcatctttggataaggagatctac
taccacggagaacctatcagcgtcaatgtccacgtcaccaacaacaccaacaagactgtg
aggaagatcaagatctcggtgcgccagtatgcagacatctgtctcttcaacacagctcag
tacaagtgcccggtggccacggaggaggctgatgacactgtggcgcccagctcaacgttc
tgcaaggtctacacgctgacccccttcctggccaacaaccgagagaagcggggactcgcc
ctggacgggaagcttaagcatgaagacacaaatctggcttccagcactctgctgagggaa
ggtgccaaccgcgagatcctggggatcatcgtttcctacaaagtgaaagcaaagctggtg
gtggctcggggcggcctgttaggagacctcgcatccagcgacgtggctgtggaactaccc
tttaccttaatgcaccccaagcctaaagaggagcccccacaccgcgaagttccagagagt
gagactccggtagacaccaatctcatagagcttgacaccaatgatgacgacattgtattt
gaggactttgcccggcagaggctgaaaggcattaaggatgacaaggacgaagaggatgat
ggcactggctctccacacctcaacaacagatag

DBGET integrated database retrieval system