KEGG   Meriones unguiculatus (Mongolian gerbil): 110557497
Entry
110557497         CDS       T05884                                 

Gene name
Traf6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04120  Ubiquitin mediated proteolysis
mun04140  Autophagy - animal
mun04144  Endocytosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04722  Neurotrophin signaling pathway
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110557497 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110557497 (Traf6)
   04064 NF-kappa B signaling pathway
    110557497 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110557497 (Traf6)
   04140 Autophagy - animal
    110557497 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110557497 (Traf6)
   04621 NOD-like receptor signaling pathway
    110557497 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    110557497 (Traf6)
   04657 IL-17 signaling pathway
    110557497 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110557497 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110557497 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110557497 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110557497 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110557497 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110557497 (Traf6)
   05135 Yersinia infection
    110557497 (Traf6)
   05133 Pertussis
    110557497 (Traf6)
   05152 Tuberculosis
    110557497 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110557497 (Traf6)
   05161 Hepatitis B
    110557497 (Traf6)
   05160 Hepatitis C
    110557497 (Traf6)
   05171 Coronavirus disease - COVID-19
    110557497 (Traf6)
   05162 Measles
    110557497 (Traf6)
   05168 Herpes simplex virus 1 infection
    110557497 (Traf6)
   05169 Epstein-Barr virus infection
    110557497 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110557497 (Traf6)
   05140 Leishmaniasis
    110557497 (Traf6)
   05142 Chagas disease
    110557497 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110557497 (Traf6)
   04121 Ubiquitin system [BR:mun04121]
    110557497 (Traf6)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110557497 (Traf6)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110557497 (Traf6)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110557497 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Sina Tropomyosin_1 DUF4455 Spc29 U-box PspA_IM30 EzrA DUF16 TACC_C UPF0242
Other DBs
NCBI-GeneID: 110557497
NCBI-ProteinID: XP_021507580
LinkDB
Position
Unknown
AA seq 530 aa
MSLLNCENSCGSSQSSSDCCAAMATSCSSAMKEDSVSVSASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALMNCPQCQRPFQKCQFNTHIIE
DCPRRQVACVNCAVTMPYEDKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPI
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLTLRPCDASSPSRGYRSED
PNYEETVKQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDRVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGDYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFVKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtctgttaaactgtgaaaacagctgtgggtccagccagtcctcaagtgactgctgt
gctgccatggccacttcctgcagttctgcaatgaaagaagacagtgtgagtgtatctgcc
tccacggggaacctctccagctccttcatggaagagatccaaggatatgatgtagagttt
gacccacctttggaaagcaagtatgagtgccctatctgcttaatggcgttacgggaagca
gtgcaaacaccatgtggccacaggttctgcaaagcctgcatcatcaaatccatcagggat
gcaggtcacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcctgac
aattttgcaaagcgagagattctttccctgacagtaaagtgcccaaataaaggctgtttg
caaaagatggaactgagacatctcgaggatcatcaagtacattgtgaatttgctctgatg
aattgtcctcaatgccaacgtcctttccaaaagtgccagtttaatacacacattattgag
gattgccccaggagacaggttgcttgtgtaaactgtgctgtgaccatgccatatgaagat
aaagagatccatgatcagagctgtcctttggcaaatatcatctgtgaatactgtggtaca
atcctcatcagagagcagatgcctaatcattatgatctagactgcccaactgctccaatc
ccttgcacattcagtgtttttggctgtcatgaaaagatgcagaggaatcacttggcacga
cacctgcaagagaatacccagttgcacatgagactgttggcccaggctgttcacaacgta
aacctcactctgcgtccgtgtgatgcttcctctccgtcccggggttatcgttcagaggac
ccaaattatgaggagactgtcaaacaattggagggccgcctagtaagacaggaccatcaa
atccgggagctgacagccaaaatggaaactcagagtatgtatgtaagcgagctcaaacga
accattcgaacccttgaggacagagttgctgaaatggaagcacagcagtgtaatgggatt
tacatttggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaaaacct
gttgtcattcatagccctggattctacacaggcagacctgggtacaagctctgcatgcgc
ctgcatcttcagttaccaacggctcagcgctgcgcaaactacatatccctttttgtccac
acaatgcaaggagactacgacagccatctcccctggcccttccagggtacaatacgcctt
acaattcttgatcagtctgaagcagtaataaggcaaaaccatgaagaggtcatggatgct
aaaccagagctgcttgcctttcagcgacccacaatcccacggaaccccaaaggttttggc
tacgtaacatttatgcacctggaagccttaagacagggaacctttgttaaggatgataca
ttattagtgcgctgcgaagtctctacgcgctttgacatgggtggccttcggaaggagggt
ttccagccacgaagcactgatgcaggggtgtag

DBGET integrated database retrieval system