KEGG   Meriones unguiculatus (Mongolian gerbil): 110558105
Entry
110558105         CDS       T05884                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04020  Calcium signaling pathway
mun04072  Phospholipase D signaling pathway
mun04144  Endocytosis
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04540  Gap junction
mun04630  JAK-STAT signaling pathway
mun04810  Regulation of actin cytoskeleton
mun05163  Human cytomegalovirus infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110558105 (Pdgfra)
   04014 Ras signaling pathway
    110558105 (Pdgfra)
   04015 Rap1 signaling pathway
    110558105 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110558105 (Pdgfra)
   04020 Calcium signaling pathway
    110558105 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110558105 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110558105 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110558105 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110558105 (Pdgfra)
   04540 Gap junction
    110558105 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110558105 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110558105 (Pdgfra)
   05206 MicroRNAs in cancer
    110558105 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110558105 (Pdgfra)
   05231 Choline metabolism in cancer
    110558105 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110558105 (Pdgfra)
   05218 Melanoma
    110558105 (Pdgfra)
   05215 Prostate cancer
    110558105 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110558105 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110558105 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110558105 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mun04090]
    110558105 (Pdgfra)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110558105 (Pdgfra)
Protein kinases [BR:mun01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110558105 (Pdgfra)
CD molecules [BR:mun04090]
 Proteins
  110558105 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 C1-set Kinase-like
Other DBs
NCBI-GeneID: 110558105
NCBI-ProteinID: XP_021508529
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHQAVLVLTCLLTGPGLILCQLLLPSILPNENEKVVQLNSSFSLRCFGESEVSWQHP
MSEEEDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLLNNGRLVLASYDSRQGFNG
TFSVGPYICEATVKGRTFKTGEFNVYALKATSELNLEMEARQTVYRSGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLLYTLTVPKATVKDSGEYECAARQATKEVK
EMKKVTISVHEKGFVEIMPTFGQLEAVNLHQVREFVVEVQAYPAPRISWLKDNLTLIENL
TEITTDIQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDVKSYTFELSTLVPASILEL
VDDQHVSGGGQTVRCTAEGTPLPDIEWMICKDIKKCNNDTSWTVLASNVSNIIMEFHRRG
RSTVEGRVSFAKVEETIAVRCLAKNDLGVGNRELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRPLYDRPASYKKKSMLDSEVKN
LLSDDGSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYDIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEDDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggccgttttggtcctcacctgtctcctcacagggccgggcctc
atcctctgccagctcttattaccctctatcctgccgaatgagaatgagaaggttgtgcag
ctgaattcgtccttttctctgagatgcttcggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaagaccccaacgtggagatcagaaacgaggagaacaacagcggcctc
tttgtgacggtgctggaagtggtgaacgcctccgcggcccacaccggctggtacacttgc
tattacaaccacactcagacggaggagagcgagatcgaaggccggcacatctacatctac
gtgccagacccggacatggcctttgtgcctctcgggatgacagactctttagtgatcgtg
gaagaggacgattccgccatcataccttgccgcaccacggatccggagactcaagtaacc
ttgctcaacaatggcaggctggtgcttgcctcttacgacagcaggcagggcttcaacggg
accttcagcgtggggccgtatatctgcgaggccaccgtcaaagggaggaccttcaagacc
ggcgagttcaacgtttatgccttgaaagcgacgtcagaactgaacctggagatggaagcc
cggcaaacggtgtacaggtcaggggaaacgatcgtggtgacctgcgctgtctttaacaat
gaggtggtggacctccagtggacttaccccggggaagtgagaaacaaaggcatcaccatg
ctggaggagatcaaactcccgtccatcaaactgctgtatactttgaccgtccccaaggcc
accgtgaaagacagcggagagtatgagtgtgcagcccgccaggccacgaaggaggtcaag
gagatgaagaaagtcaccatttctgtccacgagaaaggttttgttgagatcatgcccacc
tttggccagctggaagccgtcaacttgcatcaggtcagggagttcgtggtggaggtgcag
gcctacccggctcccaggatatcctggctgaaggacaacttgactctgatcgagaatctc
accgagatcaccactgacatccagaagagccaggaaacaaggtatcaaagcaaattaaaa
ctgatccgggctaaggaagaagacagcggacattacaccattatagttcaaaatgatgat
gacgtgaaaagttacacatttgagctgtcaactctagtgccagcatccatcctggagctt
gtggacgaccagcacgtctctggcgggggacagactgtgagatgcacggcggaaggcaca
cctctcccggacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacact
tcatggacagttttggccagcaacgtctcaaacatcatcatggagttccatcgccggggc
aggagcaccgtagagggacgagtgtcctttgccaaagtggaagagaccatcgcggttcga
tgcctggcaaagaatgaccttggcgttgggaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggcggccgcggtgctggtgctcttggtgattgtcatcgtc
tctctcattgtcctggttgtcatttggaagcagaagccacggtatgaaatccgctggagg
gtcattgagtccatcagccctgatggacacgagtatatttatgtggacccgatgcagctg
ccttatgactccagatgggaattcccgagagatggactagtacttggtcggatcttggga
tctggtgcgtttgggaaagtggttgaaggcacagcctatggattaagccggtcccagcct
gtcatgaaggtggctgtgaagatgctcaaacccacagccaggtccagcgaaaagcaagct
ctcatgtctgagctgaagataatgacgcacttgggaccacacttgaacattgtcaatttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtactgcttctatggg
gatttggtcaactatctgcataagaatagagacagcttcatgagccgacacccagagaag
ccaaagaaagacctggacatctttggattgaatcctgcagatgaaagtacaaggagttac
gtgattttatcttttgaaaacaacggagactacatggacatgaagcaagccgacaccaca
cagtacgtgcccatgcttgaaaggaaagaggtttctaagtactctgacatccagagaccg
ctgtatgaccggccagcctcctataagaagaaatctatgctagactcagaagtcaaaaac
ctcctttcggatgatggctccgagggtctgaccttgctggatttattgagcttcacctat
caagttgccagaggaatggaattcttggcttcgaaaaattgtgtccaccgggacctggct
gcccgcaacgtcctcctggcacaagggaagattgtgaagatctgtgactttggtctggcc
agagacatcatgcatgattccaactacgtgtcaaaaggcagcactttcctgcctgtgaag
tggatggcgcccgagagcatctttgacaacctctacaccacactgagtgacgtctggtct
tatggcattctgctctgggaaatcttttcccttggtggtacgccctatcctggcatgatg
gttgactctactttctacaacaagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctatgacattatggtacagtgctggaacagcgagccggagaagaga
ccttccttctaccacctgagtgagatcgtggagaatctactgcccggacagtataaaaag
agctatgaaaagattcacctggacttcctaaagagtgaccatccggctgtggcacgcatg
cgtgtggactccgacaatgcgtacatcggcgtcacttacaaaaatgaagatgacaagctg
aaggactgggaaggtggcctggacgaacagagactgagtgcagacagtggctacatcatt
cccctgccagacattgaccctgttccggaggaggatgacctgggcaagaggaacagacac
agctcccagacctcggaagagagtgccatcgagacgggctccagtagctccaccttcatc
aagagagaggatgagaccattgaggatatcgacatgatggatgacattggcatagattcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system