KEGG   Meriones unguiculatus (Mongolian gerbil): 110559281
Entry
110559281         CDS       T05884                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04072  Phospholipase D signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04640  Hematopoietic cell lineage
mun04916  Melanogenesis
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110559281 (Kitlg)
   04014 Ras signaling pathway
    110559281 (Kitlg)
   04015 Rap1 signaling pathway
    110559281 (Kitlg)
   04072 Phospholipase D signaling pathway
    110559281 (Kitlg)
   04151 PI3K-Akt signaling pathway
    110559281 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110559281 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    110559281 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110559281 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110559281 (Kitlg)
Cytokines and growth factors [BR:mun04052]
 Growth factors
  Growth factors (RTK binding)
   110559281 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 110559281
NCBI-ProteinID: XP_021510309
LinkDB
Position
Unknown
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVTG
MDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIMDDLVECMDENIP
KNVKESTKRPETRLFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGAVYWKKK
QSSLSRAVENIQINEEDNEISMLQQKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactaaggaaatctgcgggaatcctgtgactgataacgtaaaagacatc
acaaaattggtggcaaatcttccaaatgactatatgataaccctcaactatgtcaccggg
atggatgttttgcctagtcattgttggctacgagatatggtaatccaattgtcactcagc
ctgactactcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaagcttgggaaaataatggacgaccttgtggaatgtatggatgaaaacatacct
aagaatgtaaaagaatcaactaagaggccagaaaccaggctctttactcctgaagaattc
tttagtattttcaatagatccattgatgccttcaaggacttcatggtggcatcggacact
agtgattgtgtgctttcttcaacattaggtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagctgcgaagtcccctgaagacccgggcctacagtggacagccatggccctg
ccggcactcatttctcttgtcattggctttgcttttggagccgtatactggaagaagaaa
cagtcaagtctttcaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system