KEGG   Meriones unguiculatus (Mongolian gerbil): 110559286
Entry
110559286         CDS       T05884                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04390  Hippo signaling pathway
mun04810  Regulation of actin cytoskeleton
mun05200  Pathways in cancer
mun05218  Melanoma
mun05224  Breast cancer
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110559286 (Fgf1)
   04014 Ras signaling pathway
    110559286 (Fgf1)
   04015 Rap1 signaling pathway
    110559286 (Fgf1)
   04390 Hippo signaling pathway
    110559286 (Fgf1)
   04151 PI3K-Akt signaling pathway
    110559286 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110559286 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110559286 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110559286 (Fgf1)
   05218 Melanoma
    110559286 (Fgf1)
   05224 Breast cancer
    110559286 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110559286 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110559286 (Fgf1)
Cytokines and growth factors [BR:mun04052]
 Growth factors
  Growth factors (RTK binding)
   110559286 (Fgf1)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110559286 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110559286
NCBI-ProteinID: XP_021510318
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKATETGQYLAMDTDGLLYGSQTPDEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaaccttcacggccctgaccgagaagtttaatctgcctcca
ggaaactataagaagcccaaacttctctactgcagcaacggtggccacttcctcaggatc
cttcccgatggcacagtggatgggacaagagacaggagcgaccagcacattcagctgcag
ctgagtgcggaaagcgcgggcgaggtgtatataaaggctacggagactggccagtacttg
gccatggacaccgacgggcttttatacggctcgcagacaccagatgaagaatgcctgttc
ctggaaaggctggaagaaaaccattataacacttacacgtccaagaagcatgcggagaag
aactggtttgttggcctcaagaagaacggaagctgcaaacgcggtcctcggactcactac
ggccagaaagcaatcctgtttctcccccttccggtgtcttctgactag

DBGET integrated database retrieval system