KEGG   Meriones unguiculatus (Mongolian gerbil): 110559626
Entry
110559626         CDS       T05884                                 

Gene name
Mavs
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110559626 (Mavs)
   04622 RIG-I-like receptor signaling pathway
    110559626 (Mavs)
   04623 Cytosolic DNA-sensing pathway
    110559626 (Mavs)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110559626 (Mavs)
   05160 Hepatitis C
    110559626 (Mavs)
   05171 Coronavirus disease - COVID-19
    110559626 (Mavs)
   05164 Influenza A
    110559626 (Mavs)
   05162 Measles
    110559626 (Mavs)
   05168 Herpes simplex virus 1 infection
    110559626 (Mavs)
   05169 Epstein-Barr virus infection
    110559626 (Mavs)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 110559626
NCBI-ProteinID: XP_021510821
LinkDB
Position
Unknown
AA seq 493 aa
MTFAEEKTYKYICNNHSKFCCVDVWEILPYLPCLTASDQDRLRASYKQLGNQDTLWELFN
KLQRRLGWVEYFIRALRICELPGLADQVTRVYQSYLPPGTSLRTLAPLESPAIPATVSAP
SAFASGHSVPDNGYQEKPGYPSPVQDTQPPKSPVENSEQTPQANSGFIPRTSGGSVMSSP
NLQALSSSPSREQEPELAGTCAANTVSSPVPMHGPVSPTVSFQPLPRTTLRTVHLPGVTV
SVPSPDTSLSSSSTGSAFAMGDGEAKGATCLGTKEAVPTNSVTASSVPSSTKSVPVNTTP
SKVSSKFPISPKPTASTPSTNVAPSKLPINSVYAGTVASKVPATMAKPPANIMPSERSSN
LAKETLEAAATTVTAGRSLPEPEMSKPGVLVSQLDSEPFSASSVDLAISPSSSLASEPNR
GPEENEYSSFRVQVDEPPSVDLTGSPGPRATQLPPEEEVLCADSIPWAKWLGATSTLLAA
FLAVMLYRRRLAP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacatttgctgaggaaaagacctataagtatatctgcaacaaccacagcaagttttgc
tgtgttgatgtttgggagatcctgccttacctgccctgcctcacagccagtgaccaggat
cgacttcgggcttcctacaagcaactagggaaccaggacacactctgggaactcttcaat
aagctccagcgtcggcttggctgggtagagtattttatccgggcactgagaatctgtgag
ctgcctggactggctgaccaagtgactcgagtttatcagagctacctgcctcctgggacc
tcactccgcaccctagccccactggagtcgccagcaattcctgccacagtttcagcacct
tctgcatttgcatcaggccacagcgtccctgacaatggctaccaagagaaaccaggttac
cccagccctgtccaggatacccagccaccaaagtccccagtagagaattcagagcaaacc
ccacaggccaactctgggttcattccgaggacgtcgggtggctctgtgatgtcctcacct
aatctgcaagctctcagctcttcgccctccagagagcaagagccagaactggctggcacc
tgtgcagcaaatactgtctccagtcctgtaccaatgcatggacctgtgtctccaactgtt
tccttccagcctcttccacgtactaccctgcggacagtccacttacccggggtcacagta
tcagttccgtctcctgatacctccttgtcttcctcttccactggatcggcttttgcaatg
ggagacggagaggccaagggtgccacctgtctcggcactaaagaggcagtacccaccaat
tctgtgaccgccagctcagtgccttcttccaccaaatcggtaccagtgaataccacgcct
tccaaagtgtcctccaagttccctatcagtccaaagcccactgcttcaacaccgtctacc
aatgtagcgccatcaaaattacccattaactccgtgtatgctggcacagtggcatccaaa
gtgcctgccactatggccaaaccacctgccaacataatgccatctgagaggagcagtaac
ctagccaaggagaccctggaggctgcagcaaccacagtcaccgctggacgcagcctgccc
gaaccagagatgagcaagccaggtgtgctggtgtcccaactggacagcgagccattctca
gccagctccgtggaccttgccatcagccctagcagctccttggcctcagaacccaaccgt
ggtccagaggagaatgagtattcctcctttagagtccaggtggatgagccccccagtgtt
gacctgacaggaagccctgggccacgagccacccagctgcccccagaagaggaagtgctt
tgtgcggattccattccctgggctaagtggctcggggccaccagcacactcttggctgcc
ttcttggcagtgatgctgtaccgtaggcgcctggccccgtga

DBGET integrated database retrieval system