KEGG   Meriones unguiculatus (Mongolian gerbil): 110560079
Entry
110560079         CDS       T05884                                 

Definition
(RefSeq) interleukin-2-like
  KO
K05429  interleukin 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04151  PI3K-Akt signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05135  Yersinia infection
mun05142  Chagas disease
mun05162  Measles
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110560079
   04151 PI3K-Akt signaling pathway
    110560079
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110560079
   04061 Viral protein interaction with cytokine and cytokine receptor
    110560079
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110560079
   04660 T cell receptor signaling pathway
    110560079
   04658 Th1 and Th2 cell differentiation
    110560079
   04659 Th17 cell differentiation
    110560079
   04672 Intestinal immune network for IgA production
    110560079
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560079
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110560079
   05321 Inflammatory bowel disease
    110560079
   05330 Allograft rejection
    110560079
   05332 Graft-versus-host disease
    110560079
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110560079
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110560079
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110560079
   05162 Measles
    110560079
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110560079
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110560079
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110560079
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110560079
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Cytokines
   110560079
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 110560079
NCBI-ProteinID: XP_021511475
LinkDB
Position
Unknown
AA seq 162 aa
MSSSPAGMYSMQLASCVVPTLVLLVNSTLPSSPTKETQQYLEQLSLDLQQLLRGVNNYKN
PKLPMLLTFKFYMPRKATELKHLQCLKEELGPLYDVLNLVQSKNLYLEDAGNFISNIRVT
VMKLKGSENTLKCEFDDETVTVVEFLSRWIAFCQSAISTMTQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagctcaagtcctgcaggcatgtacagcatgcagctcgcatcctgcgttgtgccgacg
ctagtactccttgtcaacagtacactcccttcaagccctaccaaggagacacagcagtac
ctggagcagttgtcgctggacttacagcagcttctgagaggggtcaataattacaagaac
ccgaaactccccatgctgctcacgtttaaattttacatgccgaggaaggccacagagctg
aagcatcttcagtgcttgaaagaagaacttggacctctgtatgatgtgctaaatttggtt
caaagcaaaaacctttacttggaagatgctgggaatttcatcagcaatatcagagtgact
gtcatgaaactaaagggctcagaaaacacactcaagtgcgaatttgatgatgagacagtg
actgtggtagaattcctgagcagatggatagccttctgtcaaagtgccatctcaacaatg
actcaataa

DBGET integrated database retrieval system