KEGG   Meriones unguiculatus (Mongolian gerbil): 110560136
Entry
110560136         CDS       T05884                                 

Gene name
Tnf
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01523  Antifolate resistance
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04064  NF-kappa B signaling pathway
mun04071  Sphingolipid signaling pathway
mun04150  mTOR signaling pathway
mun04210  Apoptosis
mun04217  Necroptosis
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04612  Antigen processing and presentation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04640  Hematopoietic cell lineage
mun04650  Natural killer cell mediated cytotoxicity
mun04657  IL-17 signaling pathway
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04920  Adipocytokine signaling pathway
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04940  Type I diabetes mellitus
mun05010  Alzheimer disease
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05134  Legionellosis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05310  Asthma
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05410  Hypertrophic cardiomyopathy
mun05414  Dilated cardiomyopathy
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110560136 (Tnf)
   04350 TGF-beta signaling pathway
    110560136 (Tnf)
   04064 NF-kappa B signaling pathway
    110560136 (Tnf)
   04668 TNF signaling pathway
    110560136 (Tnf)
   04071 Sphingolipid signaling pathway
    110560136 (Tnf)
   04150 mTOR signaling pathway
    110560136 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110560136 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110560136 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110560136 (Tnf)
   04217 Necroptosis
    110560136 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110560136 (Tnf)
   04620 Toll-like receptor signaling pathway
    110560136 (Tnf)
   04621 NOD-like receptor signaling pathway
    110560136 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    110560136 (Tnf)
   04625 C-type lectin receptor signaling pathway
    110560136 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    110560136 (Tnf)
   04612 Antigen processing and presentation
    110560136 (Tnf)
   04660 T cell receptor signaling pathway
    110560136 (Tnf)
   04657 IL-17 signaling pathway
    110560136 (Tnf)
   04664 Fc epsilon RI signaling pathway
    110560136 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110560136 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110560136 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110560136 (Tnf)
  09163 Immune disease
   05310 Asthma
    110560136 (Tnf)
   05322 Systemic lupus erythematosus
    110560136 (Tnf)
   05323 Rheumatoid arthritis
    110560136 (Tnf)
   05321 Inflammatory bowel disease
    110560136 (Tnf)
   05330 Allograft rejection
    110560136 (Tnf)
   05332 Graft-versus-host disease
    110560136 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110560136 (Tnf)
   05014 Amyotrophic lateral sclerosis
    110560136 (Tnf)
   05020 Prion disease
    110560136 (Tnf)
   05022 Pathways of neurodegeneration - multiple diseases
    110560136 (Tnf)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110560136 (Tnf)
   05410 Hypertrophic cardiomyopathy
    110560136 (Tnf)
   05414 Dilated cardiomyopathy
    110560136 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110560136 (Tnf)
   04940 Type I diabetes mellitus
    110560136 (Tnf)
   04932 Non-alcoholic fatty liver disease
    110560136 (Tnf)
   04931 Insulin resistance
    110560136 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110560136 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110560136 (Tnf)
   05135 Yersinia infection
    110560136 (Tnf)
   05133 Pertussis
    110560136 (Tnf)
   05134 Legionellosis
    110560136 (Tnf)
   05152 Tuberculosis
    110560136 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110560136 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    110560136 (Tnf)
   05161 Hepatitis B
    110560136 (Tnf)
   05160 Hepatitis C
    110560136 (Tnf)
   05171 Coronavirus disease - COVID-19
    110560136 (Tnf)
   05164 Influenza A
    110560136 (Tnf)
   05168 Herpes simplex virus 1 infection
    110560136 (Tnf)
   05163 Human cytomegalovirus infection
    110560136 (Tnf)
   05169 Epstein-Barr virus infection
    110560136 (Tnf)
   05165 Human papillomavirus infection
    110560136 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110560136 (Tnf)
   05144 Malaria
    110560136 (Tnf)
   05145 Toxoplasmosis
    110560136 (Tnf)
   05140 Leishmaniasis
    110560136 (Tnf)
   05142 Chagas disease
    110560136 (Tnf)
   05143 African trypanosomiasis
    110560136 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110560136 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110560136 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110560136 (Tnf)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Tumor necrosis fators
   110560136 (Tnf)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Cytokines
   110560136 (Tnf)
SSDB
Motif
Pfam: TNF CRISPR_assoc
Other DBs
NCBI-GeneID: 110560136
NCBI-ProteinID: XP_021511575
LinkDB
Position
Unknown
AA seq 235 aa
MSRESMISDIELAEEALPQKSAGAQGSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
EEKFPNGLPIISSMAQTLTLRSSSQNASDKPVAHVVANHQVEEQLEWLSRRANALLANGM
ELRDNQLVVPSDGLYLVYSQALFKGQGCPHLVLLTHTVSRFAVSYQDKVSLLSAIKSPCP
RDAPEGAEPEPWYEPIYLGGVFQLEKGDRLSAEVNLPQYLDFAEPGQVYFGVIAL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagcagagagagcatgatcagcgacatcgagctggcggaggaggcgctcccccagaag
tcggcgggcgcccagggctccaggcgctgcctgtgcctcagcctcttctctttcctgctc
gtggcgggggccaccacgctcttctgtctcctgaacttcggggtgattggcccccaaagg
gaagagaagttcccaaacggcctccccatcatcagctccatggcccagaccctcacactc
aggtcctcttctcagaacgccagcgacaagcctgtggcccatgtcgtagccaaccaccaa
gtggaggagcagctggagtggctgagccggcgtgccaacgccctcctggccaacggcatg
gagctcagggacaaccagctggtggtgccatcggacgggctgtacctcgtgtactcccag
gccctcttcaaggggcaaggctgcccccacctcgtgctcctcacgcacaccgtcagccgc
ttcgctgtctcctaccaggacaaggtcagcctcctgtctgccatcaagagcccctgcccc
agggacgcacccgagggggccgagcccgagccctggtacgagcccatctacctgggcggg
gtcttccagctggagaagggagaccgactcagcgccgaggtcaacctgccccagtactta
gacttcgccgaacccgggcaggtctactttggagtcatcgctctgtga

DBGET integrated database retrieval system