KEGG   Meriones unguiculatus (Mongolian gerbil): 110560654
Entry
110560654         CDS       T05884                                 

Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04071  Sphingolipid signaling pathway
mun04115  p53 signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04722  Neurotrophin signaling pathway
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05216  Thyroid cancer
mun05217  Basal cell carcinoma
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110560654
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110560654
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110560654
   04215 Apoptosis - multiple species
    110560654
   04217 Necroptosis
    110560654
   04115 p53 signaling pathway
    110560654
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110560654
  09149 Aging
   04211 Longevity regulating pathway
    110560654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560654
   05202 Transcriptional misregulation in cancer
    110560654
   05203 Viral carcinogenesis
    110560654
  09162 Cancer: specific types
   05210 Colorectal cancer
    110560654
   05212 Pancreatic cancer
    110560654
   05225 Hepatocellular carcinoma
    110560654
   05226 Gastric cancer
    110560654
   05214 Glioma
    110560654
   05216 Thyroid cancer
    110560654
   05220 Chronic myeloid leukemia
    110560654
   05217 Basal cell carcinoma
    110560654
   05218 Melanoma
    110560654
   05213 Endometrial cancer
    110560654
   05224 Breast cancer
    110560654
   05222 Small cell lung cancer
    110560654
   05223 Non-small cell lung cancer
    110560654
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110560654
   05014 Amyotrophic lateral sclerosis
    110560654
   05016 Huntington disease
    110560654
   05020 Prion disease
    110560654
   05022 Pathways of neurodegeneration - multiple diseases
    110560654
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110560654
   04933 AGE-RAGE signaling pathway in diabetic complications
    110560654
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110560654
   05152 Tuberculosis
    110560654
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110560654
   05170 Human immunodeficiency virus 1 infection
    110560654
   05161 Hepatitis B
    110560654
   05160 Hepatitis C
    110560654
   05164 Influenza A
    110560654
   05162 Measles
    110560654
   05168 Herpes simplex virus 1 infection
    110560654
   05163 Human cytomegalovirus infection
    110560654
   05167 Kaposi sarcoma-associated herpesvirus infection
    110560654
   05169 Epstein-Barr virus infection
    110560654
   05165 Human papillomavirus infection
    110560654
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110560654
   01524 Platinum drug resistance
    110560654
   01522 Endocrine resistance
    110560654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mun03029]
    110560654
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110560654
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110560654
Transporters [BR:mun02000]
 Other transporters
  Pores ion channels [TC:1]
   110560654
SSDB
Motif
Pfam: Bcl-2 CF222 Bclx_interact
Other DBs
NCBI-GeneID: 110560654
NCBI-ProteinID: XP_021512320
LinkDB
Position
Unknown
AA seq 191 aa
MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIHDRAGRMAGETPELTLQQPPQDASTKKLS
ECLRRIGDELDSNMELQRMIADVDTNSPREVFFRVAAEMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIKTIMDWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKMS
NT seq 576 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagctcggaggcggcgggcccaccagctctgagcagatcatg
aagacaggggcctttttgctgcagggtttcatccatgatcgcgcggggaggatggcaggg
gagacaccggagctgaccctgcagcagccaccccaggatgcatccaccaagaagctgagc
gagtgtctcaggcgaatcggcgatgagctggatagcaacatggagctgcagaggatgatt
gccgacgtggatacgaactctccccgagaggtcttcttccgggtggcagctgaaatgttt
gctgatggcaacttcaactggggccgtgttgttgccctcttctactttgctagcaaactg
gtgctcaaggccctgtgcaccaaagtgccggagctaatcaaaaccatcatggactggacg
ctggacttcctccgagaacggctgcttgtctggatccaagaccagggtggctgggatggc
ctcctctcatactttgggacccccacatggcagacagtgaccatctttgtggctggagtt
ctcactgcctcactcaccatctggaagatgagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560658
Entry
110560658         CDS       T05884                                 

Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04071  Sphingolipid signaling pathway
mun04115  p53 signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04722  Neurotrophin signaling pathway
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05216  Thyroid cancer
mun05217  Basal cell carcinoma
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110560658
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110560658
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110560658
   04215 Apoptosis - multiple species
    110560658
   04217 Necroptosis
    110560658
   04115 p53 signaling pathway
    110560658
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110560658
  09149 Aging
   04211 Longevity regulating pathway
    110560658
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560658
   05202 Transcriptional misregulation in cancer
    110560658
   05203 Viral carcinogenesis
    110560658
  09162 Cancer: specific types
   05210 Colorectal cancer
    110560658
   05212 Pancreatic cancer
    110560658
   05225 Hepatocellular carcinoma
    110560658
   05226 Gastric cancer
    110560658
   05214 Glioma
    110560658
   05216 Thyroid cancer
    110560658
   05220 Chronic myeloid leukemia
    110560658
   05217 Basal cell carcinoma
    110560658
   05218 Melanoma
    110560658
   05213 Endometrial cancer
    110560658
   05224 Breast cancer
    110560658
   05222 Small cell lung cancer
    110560658
   05223 Non-small cell lung cancer
    110560658
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110560658
   05014 Amyotrophic lateral sclerosis
    110560658
   05016 Huntington disease
    110560658
   05020 Prion disease
    110560658
   05022 Pathways of neurodegeneration - multiple diseases
    110560658
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110560658
   04933 AGE-RAGE signaling pathway in diabetic complications
    110560658
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110560658
   05152 Tuberculosis
    110560658
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110560658
   05170 Human immunodeficiency virus 1 infection
    110560658
   05161 Hepatitis B
    110560658
   05160 Hepatitis C
    110560658
   05164 Influenza A
    110560658
   05162 Measles
    110560658
   05168 Herpes simplex virus 1 infection
    110560658
   05163 Human cytomegalovirus infection
    110560658
   05167 Kaposi sarcoma-associated herpesvirus infection
    110560658
   05169 Epstein-Barr virus infection
    110560658
   05165 Human papillomavirus infection
    110560658
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110560658
   01524 Platinum drug resistance
    110560658
   01522 Endocrine resistance
    110560658
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mun03029]
    110560658
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110560658
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110560658
Transporters [BR:mun02000]
 Other transporters
  Pores ion channels [TC:1]
   110560658
SSDB
Motif
Pfam: Bcl-2 CF222 Bclx_interact
Other DBs
NCBI-GeneID: 110560658
NCBI-ProteinID: XP_021512324
LinkDB
Position
Unknown
AA seq 191 aa
MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIHDRAGRMAGETPELTLQQPPQDASTKKLS
ECLRRIGDELDSNMELQRMIADVDTNSPREVFFRVAAEMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIKTIMDWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKMS
NT seq 576 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagctcggaggcggcgggcccaccagctctgagcagatcatg
aagacaggggcctttttgctgcagggtttcatccatgatcgcgcggggaggatggcaggg
gagacaccggagctgaccctgcagcagccaccccaggatgcatccaccaagaagctgagc
gagtgtctcaggcgaatcggcgatgagctggatagcaacatggagctgcagaggatgatt
gccgacgtggatacgaactctccccgagaggtcttcttccgggtggcagctgaaatgttt
gctgatggcaacttcaactggggccgtgttgttgccctcttctactttgctagcaaactg
gtgctcaaggccctgtgcaccaaagtgccggagctaatcaaaaccatcatggactggacg
ctggacttcctccgagaacggctgcttgtctggatccaagaccagggtggctgggatggc
ctcctctcatactttgggacccccacatggcagacagtgaccatctttgtggctggagtt
ctcactgcctcactcaccatctggaagatgagctga

DBGET integrated database retrieval system