KEGG   Meriones unguiculatus (Mongolian gerbil): 110560752Help
Entry
110560752         CDS       T05884                                 

Gene name
Ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00590  Arachidonic acid metabolism
mun01100  Metabolic pathways
mun04611  Platelet activation
mun04726  Serotonergic synapse
mun04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110560752 (Ptgs1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110560752 (Ptgs1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110560752 (Ptgs1)
  09156 Nervous system
   04726 Serotonergic synapse
    110560752 (Ptgs1)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110560752 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 110560752
NCBI-ProteinID: XP_021512452
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MSRKNPSLQFPLLLLLLLLLTPQPPVLLADTAAPSPVNPCCYYPCQNQGVCVRFGLDRYQ
CDCTRTGFSGPNCTVPEIWTWLRNSLRPSPSFTHFLLTHGRWFWKFVNATFIREVLMRLV
LTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRVLPSVPKDCPTPMGTKGKKQLPDVQL
LAQRLLLRRKFIPAPQGTNIMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGD
NLERQYRLRLFKDGKLKYQVLGGEVYPPSVGQVSVLMHYPPGVPPEKQMAVGQEVFGLLP
GLMLFSTIWLREHNRVCDLLKEEHPTWEDEQLFQTARLILIGETIKIIIEEYVQHLSGYF
LQLKFDPELLFRAQFQYRNRIAIEFNHLYHWHPLMPDSFRVGSQEYSYEQFLFNTSMLVD
YGVEALVDSFSRQRAGRIGGGRNFDPHVLHVAIDVIKESRDLRLQPFNEYRKRFGMKPYT
SFQELTGRWLLPQHCLCQAL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaaagaatccctcgcttcagttcccgctgctgctgctgctgctgctgctgctg
acgccacaacccccggtcctgttggcggacactgcggcgccctcaccggtcaacccctgt
tgttactacccgtgtcagaaccagggcgtctgtgtccgctttggcctcgaccgctaccag
tgtgactgtactcgcacgggcttctcgggccccaactgtaccgtccctgagatctggacg
tggctgcggaattccctgcggcccagcccctcattcacgcatttcctgctgacgcacggg
cgctggttctggaagtttgtgaatgccaccttcatccgcgaagtgctcatgcgcctggtg
ctcacagttcggtccaacctcatccccagccccccaacctacaattcggcacacgactac
atcagctgggagtccttctccaacgtgagctactacacccgggtcctgccctccgtaccc
aaagactgccccacacctatggggaccaaagggaagaaacagttgccagatgtccagctt
ctggcccagcgcctgctgctgagaaggaagttcattcctgccccccagggcaccaacatc
atgtttgccttctttgcacaacatttcacccaccaattcttcaagacctctggaaagatg
ggtcctggcttcaccaaggccttgggccatggggtggaccttggtcacatttatggagat
aatctggaacgacagtatcgcctgcggctcttcaaggatgggaaactcaagtaccaggtg
ctgggcggagaggtgtacccgccttccgtgggacaggtgtctgtgttgatgcactacccg
ccgggggttccgcccgagaagcagatggccgtgggccaggaggtgtttgggctgctcccg
gggctgatgctcttctccaccatctggctgcgtgagcacaaccgcgtgtgcgacctgctg
aaggaggagcaccccacctgggaggacgagcagctcttccagaccgcccgcctcatcctc
ataggggaaaccatcaaaattatcattgaagagtacgtgcagcacttgagtggctatttc
ctgcagctcaagtttgacccggagctgctgttccgagcccagttccagtaccgcaatcgc
atcgccattgagttcaaccatctctaccactggcacccactcatgcctgactccttcaga
gtgggctcacaagagtacagctacgagcagttcttgtttaacacctccatgctggtggac
tatggtgttgaggcgctggtggactccttctctcgccagagggctggccggattggtggg
ggcaggaactttgacccccacgtcctgcacgtggccatagatgtcatcaaggagtcccga
gaccttcgcctgcagcccttcaatgagtacagaaagcggtttggcatgaagccttacacc
tctttccaggagctcacgggtaggtggctgcttcctcaacactgtctctgccaagcattg
taa

DBGET integrated database retrieval system