KEGG   Meriones unguiculatus (Mongolian gerbil): 110560955
Entry
110560955         CDS       T05884                                 

Gene name
Gusb
Definition
(RefSeq) beta-glucuronidase isoform X1
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00531  Glycosaminoglycan degradation
mun00860  Porphyrin and chlorophyll metabolism
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04142  Lysosome
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00076  Dermatan sulfate degradation
mun_M00077  Chondroitin sulfate degradation
mun_M00078  Heparan sulfate degradation
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110560955 (Gusb)
   00053 Ascorbate and aldarate metabolism
    110560955 (Gusb)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110560955 (Gusb)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    110560955 (Gusb)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110560955 (Gusb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110560955 (Gusb)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     110560955 (Gusb)
SSDB
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Other DBs
NCBI-GeneID: 110560955
NCBI-ProteinID: XP_021512823
LinkDB
Position
Unknown
AA seq 648 aa
MSPRRSACWVALGQLLCSCALALQGGMLFPRESPSRELRALDGLWRFRADLSANRLRGFE
QQWYRRPLRESGPTLDMPVPSSFNDITQEAELQNFIGWVWYEREAILPQRWTQDPQMRVV
LRINSAHYYAVVWVNGIHVVEHEGGHLPFEADISKLVQSGPLTTCRLTIAINNTLTPHTL
PPGTIVYKNDTSRYPKGYFVQDIEFDFFNYAGLHRSVVLYTTPTAYIDDITVTTNVDQDV
GLVNYWVSVQGSEQFQLEVRLLDEDGKVVAHGTEGRGQLRVPSANLWWPYLMHEQPAYLY
SLEVRMTTAESVSDFYTLPVGIRTVAVTESKFLINGKPFYFHGVNKHEDSDIRGKGFDWP
LLVKDFNLLRWLGANSFRTSHYPYAEEVLQLCDRYGIVVIDESPGVGIKLPQSFGNESLR
HHLEVMEELVRRDKNHPAVVMWSVANEPSSALLPAAYYFKTLITHTKALDPTRPVTFVTN
ARYDADLGAPYVDVICVNSYFSWYHDYGHLEVIQIQLKSQFESWYETHQKPIIQSEYGAD
AITGFHEDPPCMFSEEYQKALLENYHLVLDQKRKEYVVGELIWNFADFMTSQKPMRVIGN
KKGIFTRQRQPKSAAFTLRERYWRIANESRHHHPVPGTQCLGTRPFTF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtcccccaggcggagcgcgtgctgggtcgcgctgggccagctgctgtgcagctgcgcg
ctggcgctgcagggcgggatgctgttcccgagagagagcccgtcgcgggagctcagggcg
ctggacggactgtggcgcttccgcgcggacctctcagccaaccggctgcggggcttcgag
cagcagtggtaccggcggccgctgcgggagtccggtccgaccttggacatgcctgtccca
tccagcttcaatgacatcacccaagaagcagagcttcagaactttattggctgggtgtgg
tatgaacgggaagcaatcctgccccagcgatggacccaagacccccagatgagagtggtg
ttgaggatcaacagtgcccattactatgctgttgtgtgggtgaatgggattcatgtggtg
gagcatgagggaggtcacctcccttttgaggctgacatcagcaagctggtccagagtggg
cccctgaccacctgccggctcaccatcgccatcaacaacacactgacccctcacaccctg
ccaccagggaccattgtctacaaaaacgatacctccaggtatcccaagggatactttgtt
caggacatagagtttgacttcttcaactacgcgggattgcatcgctctgtggtcctctac
accacccccaccgcctacattgatgacatcactgtgaccactaacgtggaccaagacgtc
gggctggtgaattactgggtttccgtccagggcagtgaacagtttcagctagaagtgcgt
cttttggatgaggatggtaaagtcgtggcccatggaacagagggccggggccaacttcgg
gtgcctagtgccaacctctggtggccttacctcatgcatgagcagccagcctacctgtac
tccttggaggtgaggatgacaacagctgagtctgtgtccgacttctacaccctccccgtc
gggattcgaaccgtggctgtcacagagagcaagttcctcataaacgggaagcctttctat
ttccacggtgtcaacaagcacgaggattccgatatccgagggaaaggcttcgactggccg
ctgctggtgaaggatttcaacctgctgcgttggcttggggccaactccttccgcaccagc
cactacccctacgcggaggaggtgcttcagctctgtgaccgctacggaattgtggtcatt
gacgagagtcccggtgtgggcatcaagctgccgcagagttttggcaacgaatctcttcgg
caccacctagaggtgatggaggagctggtgcgtagggacaaaaatcacccagcggttgtg
atgtggtctgtggccaatgagccttcttccgccctgctgcctgccgcttactacttcaag
acgctgatcacccacaccaaagccctggaccccacccgtcctgtgacctttgtgaccaac
gccagatatgatgcagacctgggggccccgtacgtggatgtcatctgtgtgaacagctac
ttctcctggtatcatgactatgggcatttggaggtgattcagatacagctgaagagccag
tttgagagctggtacgagactcaccagaagccaatcatccagagcgagtatggagcagac
gcaatcacagggtttcacgaggatccaccttgcatgttcagtgaagagtaccagaaggct
ctcctggagaattatcatttggtgctggatcagaaacggaaggagtatgtggtcggagag
ctcatctggaattttgctgactttatgactagccagaaaccaatgagagtaatagggaac
aagaagggaatctttactcgtcagagacaacccaaaagtgcagcctttactttgcgagag
agatactggaggattgccaatgaaagcagacatcaccatccagtgccggggacccagtgt
ttgggaaccagaccatttacattctaa

DBGET integrated database retrieval system