KEGG   Meriones unguiculatus (Mongolian gerbil): 110561067Help
Entry
110561067         CDS       T05884                                 

Gene name
Kmt5c
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110561067 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110561067 (Kmt5c)
Enzymes [BR:mun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     110561067 (Kmt5c)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110561067 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110561067
NCBI-ProteinID: XP_021512999
LinkDB All DBs
Position
Unknown
AA seq 469 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPAPTLRRQHYLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQTRAPRQEAALKTHIFCYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLEMLVGCIADLREEDEYLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERNGEG
AFRLQPREPDKPDKLQPQALDKYDLRETKRRLQQGQDSSQQSLMSLWGCSHQSPLRRDPF
CAACQPPCLLPASPHLDYLPLWLQWMSPPQPRVRPRKRRRPRIRQASLTPVFHTASVSLH
RWGGCGPHCQLQAEAVVTLPLLPQTCWTPQQDWYWARRYGLPSVVRVKLNRLAPALPAAP
APAGSPGPVPTPDLIPKQALAFAPFCPPKRLRLVVSHGSIDLDINSGEP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggccctgacagagtgacagcccgagaactgtgcgagaatgatgacctggctaccagc
cttgttcttgacccctacctcggcttccgaacccataagatgaatgtcagccctgcgccc
acccttcgacgacaacactaccttcgctcagcactggaagctttcctgaggcaacgggac
ctggaggctgcataccgggccctgacactgggaggctggatggcccactacttccagacc
cgggcccctcggcaggaagctgccctcaagacccacattttttgctacctccgagccttc
ctgcctgagagtggcttcaccattctaccctgtacacgctactccatggagaccaatggg
gccaagattgtgtctacacgtgcttggaagaagaatgagaagctggagatgctggtgggc
tgcattgcagacctgcgtgaagaagacgagtatctgcttagggctggggagaatgacttc
agcatcatgtattccacacgcaaaaggagtgcccagttgtggcttggtccggctgctttc
atcaaccatgactgcaaacccaattgcaagtttgtgccctcagatgggaatactgcctgt
gtgaaggtgctacgagacattgagccaggggacgaagtcacatgcttttatggcgagggc
ttctttggtgagaagaatgaacactgtgaatgccacacctgcgagaggaatggcgagggg
gctttcagactgcagcccagggagccagacaagccagacaagctgcagccacaggccctg
gacaagtatgatctccgagagacaaagcggcgtctgcagcagggccaggacagcagccag
cagagcttgatgagcctgtggggctgctcccatcagtccccactgcgccgtgacccattc
tgtgctgcctgccagcccccatgcctgctgcctgccagcccccacttggactacttgccc
ctctggctccagtggatgtccccgccccagcccagagtacgtccccggaagcggcgccgc
cctaggatccgtcaggcttcattgacccctgtcttccacactgccagtgtctccctacac
cgatggggaggctgtggtccccactgccaactacaggcagaggccgtggtgaccctaccc
ctgctcccccagacctgctggaccccacaacaggactggtactgggcccggcgctatggg
ctaccttctgtggtgcgtgtgaaacttaaccgcctagcccctgccctaccagctgctcct
gcccctgctgggagcccaggccctgtccccacccccgaccttatccctaagcaggccctt
gccttcgctcctttctgcccacctaagcgcctccggctagtggtcagtcatggttccatt
gatctggacatcaatagtggtgagccatga

DBGET integrated database retrieval system