KEGG   Meriones unguiculatus (Mongolian gerbil): 110561376
Entry
110561376         CDS       T05884                                 

Gene name
Ripk1
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04064  NF-kappa B signaling pathway
mun04210  Apoptosis
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05160  Hepatitis C
mun05163  Human cytomegalovirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110561376 (Ripk1)
   04668 TNF signaling pathway
    110561376 (Ripk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110561376 (Ripk1)
   04217 Necroptosis
    110561376 (Ripk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110561376 (Ripk1)
   04621 NOD-like receptor signaling pathway
    110561376 (Ripk1)
   04622 RIG-I-like receptor signaling pathway
    110561376 (Ripk1)
   04623 Cytosolic DNA-sensing pathway
    110561376 (Ripk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110561376 (Ripk1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110561376 (Ripk1)
   05160 Hepatitis C
    110561376 (Ripk1)
   05163 Human cytomegalovirus infection
    110561376 (Ripk1)
   05169 Epstein-Barr virus infection
    110561376 (Ripk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110561376 (Ripk1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110561376 (Ripk1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   110561376 (Ripk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death RHIM Pkinase_fungal Kinase-like RIO1 Kdo
Other DBs
NCBI-GeneID: 110561376
NCBI-ProteinID: XP_021513438
LinkDB
Position
Unknown
AA seq 658 aa
MQPDMSLDNIKMASSDLLEKQDLDSGGFGKVSLCLHRSHGFVILKKVYTGSNCAEYNEAL
LEEGKMMHRLRHNRVVKLLGVIMEEGNYSLVMEYMEKGNLMHVLKAEVSVPLSVKGRIIL
ETIEGMCYLHDKGVIHKDLKPENILVDHDFHIKIADLGVASFKTWSKLTKEELNKQREVN
SSSKKNGGTLYYMAPEHLNDINAKPTEKSDVYSFAIVLWAIFANKEPYENVICAEQFVVC
IKSGNRPDVEDIIEHCPREIISLMERCWQATPEDRPTFPDIGKEFKPFYLSQLEEFVEED
VASLKKEYPDQSSNLKRLYSLQNDCVPLPPSRSNSEQPHSLHSSQGLPMGPVEESWFSSS
PEYPQEENERSVQAKLQEEASYHAFGRFTEKQTKPQPRQNAAYDREEERRRRVSHDPFAQ
QRARENVKSAGAKGLSNPSTSSSANAAPQLSGPGSQAQVPLWNNGLYNQHGFGTAGAGSW
YGPNPSQMFNTYKTPVPETNLSGSTPTAPFISLPLTDESLRYTILNSSGIQIGNYNYMDL
GLSSQPPDFLLKEESASKYQAIFDNTTSLTDKHLNPVRENLGRQWKNCARKLGFTESQID
EIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLARALHQCCRLDLLNHLIQASRS
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgcaaccagatatgtccctggacaacattaaaatggcatccagcgatctgctggagaag
caagatctagacagcggaggctttgggaaggtgtccttgtgtttgcacagaagccatgga
tttgtcatcctgaaaaaagtgtacacagggtccaactgtgctgagtacaacgaggctctc
ctggaggaggggaagatgatgcacagactgagacacaatcgcgtggtgaagctactgggc
gtcatcatggaggaagggaactactccctggtgatggagtacatggaaaagggcaacctg
atgcacgtgctgaaggctgaggtcagtgtcccgctctctgtaaaaggaaggataattttg
gagaccatcgaaggaatgtgttacttacacgacaaaggcgtgatacataaggacctaaag
cctgaaaatatcctcgttgaccatgactttcacatcaagatagctgatctcggtgtagct
tcctttaagacgtggagcaaactgactaaggaggagctcaacaagcagagggaggtgaac
agctcctctaagaagaatggaggcaccctgtactacatggcgcccgagcacctgaatgac
atcaatgcaaagcccacagagaagtccgatgtgtacagctttgccattgtactgtgggca
atatttgcaaataaggagccctatgagaatgtcatctgtgctgagcagttcgtcgtctgc
ataaagtctgggaacaggccagacgtggaggacatcattgagcactgcccacgggagatc
atcagcctcatggagcggtgttggcaagcgaccccagaagaccggccaacatttcctgac
attgggaaagaatttaaacctttttacttgagccaactggaagaatttgtagaagaggat
gtggcaagtttaaagaaagagtatccagatcaaagctcaaatttgaagagattgtattct
ctccagaatgattgtgtgcctttacctccaagcaggtcaaattcagagcaaccccattca
ctgcacagctcccagggactcccgatggggcctgtggaggagtcctggttttcttcctcc
ccagagtacccacaggaagagaatgaacgtagcgtgcaggctaaactccaggaggaagcc
agctatcatgctttcggaagattcacggagaaacagacaaaaccacagccaaggcagaat
gcagcttatgacagagaggaggaaaggaggcggcgggtctcccatgacccctttgcgcag
caaagagctcgtgagaatgttaagagcgcaggagctaaaggtctttccaatcccagcaca
agcagttccgcaaatgcagcaccccagctgtcggggccaggcagccaagcgcaagtgcca
ctttggaacaacggattatataatcagcatgggtttggaactgcaggtgcaggaagttgg
tatgggccaaatccaagccagatgtttaacacttataaaacgccagtgcctgagaccaac
ctatcaggaagcacacccaccgctcccttcatctccttgccgctaacagatgagtcctta
agatataccatactcaacagttctggcattcagattggaaactacaattatatggacctt
ggactgagttcacaaccaccagacttcttgctcaaagaagagtcagcttccaagtaccaa
gccatctttgataacaccactagtctgactgataaacacctgaaccctgtcagggaaaac
ctggggaggcagtggaaaaactgtgcccgcaagctgggtttcacagagtctcagatcgat
gaaattgaccacgactatgaaagagacgggttgaaagaaaaggtgtaccaaatgcttcag
aagtggctgatgcgggaaggcaccaagggggccacggtgggaaaattggcccgggcgctt
caccagtgttgcagactagacctgctgaaccacttgatacaagccagccggagctaa

DBGET integrated database retrieval system