KEGG   Meriones unguiculatus (Mongolian gerbil): 110561521
Entry
110561521         CDS       T05884                                 

Gene name
Fas
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04217  Necroptosis
mun04650  Natural killer cell mediated cytotoxicity
mun04668  TNF signaling pathway
mun04932  Non-alcoholic fatty liver disease
mun04940  Type I diabetes mellitus
mun05010  Alzheimer disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05320  Autoimmune thyroid disease
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110561521 (Fas)
   04668 TNF signaling pathway
    110561521 (Fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561521 (Fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110561521 (Fas)
   04217 Necroptosis
    110561521 (Fas)
   04115 p53 signaling pathway
    110561521 (Fas)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110561521 (Fas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561521 (Fas)
   05205 Proteoglycans in cancer
    110561521 (Fas)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110561521 (Fas)
   05330 Allograft rejection
    110561521 (Fas)
   05332 Graft-versus-host disease
    110561521 (Fas)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110561521 (Fas)
   05022 Pathways of neurodegeneration - multiple diseases
    110561521 (Fas)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110561521 (Fas)
   04932 Non-alcoholic fatty liver disease
    110561521 (Fas)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110561521 (Fas)
   05161 Hepatitis B
    110561521 (Fas)
   05160 Hepatitis C
    110561521 (Fas)
   05164 Influenza A
    110561521 (Fas)
   05162 Measles
    110561521 (Fas)
   05168 Herpes simplex virus 1 infection
    110561521 (Fas)
   05163 Human cytomegalovirus infection
    110561521 (Fas)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110561521 (Fas)
   05169 Epstein-Barr virus infection
    110561521 (Fas)
   05165 Human papillomavirus infection
    110561521 (Fas)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110561521 (Fas)
   05143 African trypanosomiasis
    110561521 (Fas)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110561521 (Fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110561521 (Fas)
   04090 CD molecules [BR:mun04090]
    110561521 (Fas)
Cytokine receptors [BR:mun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110561521 (Fas)
CD molecules [BR:mun04090]
 Proteins
  110561521 (Fas)
SSDB
Motif
Pfam: TNFR_c6 Death Chordopox_A13L
Other DBs
NCBI-GeneID: 110561521
NCBI-ProteinID: XP_021513646
LinkDB
Position
Unknown
AA seq 310 aa
MLWIWAGLPLVLAGSQLSVLTQDNDSFSVALELRRNVREIDTGCPEGLYRDGEFCCQPCQ
PGERKHSSCTGSGSKPICQSCTEGKDYMDKKHYSDKCRRCALCDGGHGLEVEANCTPTQN
TKCRCKEGFYCDTSVCEHCEVCVSCEHGVLEECTRTSNTKCKGKGPSSLLWLLLLIIPVL
VIPFVLYKKYWRRSHDDPESETSKPENVPMNFGDDNLSKYLPIIAEQMTINQVKTFARVN
KIPETKIDEIKNDHIGDTAEQKIQLLQCWYQSHGKKDAYHAFVKGLKKAHCCTVAERFQA
IVRQDSEHSV
NT seq 933 nt   +upstreamnt  +downstreamnt
atgctgtggatctgggctggcctgcctctggtgcttgctggatcccagttaagtgttctt
acccaagataatgatagcttctctgtggcattggagttgagaaggaatgttcgtgaaatc
gatactggctgcccagaaggattatatcgtgatggtgaattttgctgtcaaccatgccag
cctggtgaacgaaaacattcgagctgcacaggcagtgggagtaaaccaatctgccaatcg
tgcacagaagggaaggattacatggacaaaaagcattactctgataaatgcagaagatgt
gcgctctgtgatggagggcatggtttagaagtggaagcaaactgcaccccaacccagaat
accaagtgcagatgcaaagaaggcttctattgtgatacttctgtctgtgaacactgtgaa
gtctgcgtctcgtgtgaacacggagtccttgaagagtgcacacgaaccagcaatactaaa
tgcaaggggaaaggccccagcagtctcctatggttgctgttgttgatcatccctgttttg
gtaataccgtttgtgttatataaaaagtactggagaagaagccatgatgaccctgaatct
gaaacctcaaaacctgaaaatgtgccaatgaatttcggagatgataacttgagtaaatac
ctcccaattattgctgaacaaatgactataaatcaagttaaaacatttgctcgggtgaat
aagatccctgagacgaagatagacgagatcaagaatgaccatatcggagacacagctgag
cagaaaatccagctgcttcagtgctggtatcagtctcatgggaagaaggatgcatatcac
gccttcgttaaaggtctcaaaaaagcccactgttgcactgtggctgaaagatttcaggcc
atcgtccggcaggacagtgagcattcagtttag

DBGET integrated database retrieval system