KEGG   Meriones unguiculatus (Mongolian gerbil): 110561677
Entry
110561677         CDS       T05884                                 

Gene name
Map2k3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X1
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04218  Cellular senescence
mun04620  Toll-like receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04714  Thermogenesis
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110561677 (Map2k3)
   04015 Rap1 signaling pathway
    110561677 (Map2k3)
   04668 TNF signaling pathway
    110561677 (Map2k3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110561677 (Map2k3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110561677 (Map2k3)
   04664 Fc epsilon RI signaling pathway
    110561677 (Map2k3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110561677 (Map2k3)
   04935 Growth hormone synthesis, secretion and action
    110561677 (Map2k3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110561677 (Map2k3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110561677 (Map2k3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110561677 (Map2k3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110561677 (Map2k3)
   05022 Pathways of neurodegeneration - multiple diseases
    110561677 (Map2k3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110561677 (Map2k3)
   05135 Yersinia infection
    110561677 (Map2k3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110561677 (Map2k3)
   05161 Hepatitis B
    110561677 (Map2k3)
   05169 Epstein-Barr virus infection
    110561677 (Map2k3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110561677 (Map2k3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110561677 (Map2k3)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110561677 (Map2k3)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: STE group
  STE7 family
   110561677 (Map2k3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1
Other DBs
NCBI-GeneID: 110561677
NCBI-ProteinID: XP_021513858
LinkDB
Position
Unknown
AA seq 347 aa
MESPAASRPATLPQTKGKSKKKKDLRITCITKPPVPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDMSLDKFYRKVLEKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVD
FTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcccccgccgcgagccggccggccaccttgccccagaccaaaggaaaatccaaa
aagaaaaaggatttacggataacctgcataaccaagccacccgtgcccaaccccacacct
ccccggaacctggactcccggaccttcatcactatcggagacaggaactttgaggtggag
gctgatgacttggtgaccatctcagagctgggccgtggagcctacggggtggtggagaag
gtgcggcatgctcagagcggcaccatcatggccgtaaagcgtatccgggccactgtgaac
tcacaggagcagaaacgcctgcttatggaccttgacatcaacatgcgcacggtcgactgc
ttttacaccgtcaccttctacggcgccctcttcagagagggggatgtgtggatctgcatg
gagctcatggacatgtccctggacaagttctaccggaaggtgctggagaagaacatgaca
atcccagaggacatcctgggcgagatcgctgtgtctatcgtgcgggccctggagcacctg
cacagcaagctgtcggtgatccacagagatgtgaagccgtccaatgtcctcatcaacaag
gaggggcatgtgaagatgtgcgacttcggcatcagtggctacctggtggactccgtggca
aagacgatggatgctggctgcaagccttacatggcccctgagaggatcaacccagagctg
aatcagaagggctacaatgtcaagtctgacgtctggagccttggcatcaccatgatcgag
atggccattctgcgcttcccgtatgagtcttgggggacaccgttccagcagctgaagcag
gtggtggaggaaccatccccacagctcccagctgaccagttctcccctgagtttgtggac
ttcactagccagtgcctaaggaagaaccccgcggagcgcatgagctacctggagctgatg
gagcaccctttcttcaccttgcacaaaactaagaagacggacattgctgcgtttgtgaag
gagatcctgggagaagactcatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563014
Entry
110563014         CDS       T05884                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6-like
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04218  Cellular senescence
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110563014
   04015 Rap1 signaling pathway
    110563014
   04668 TNF signaling pathway
    110563014
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110563014
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110563014
   04664 Fc epsilon RI signaling pathway
    110563014
  09152 Endocrine system
   04912 GnRH signaling pathway
    110563014
   04935 Growth hormone synthesis, secretion and action
    110563014
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110563014
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110563014
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110563014
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110563014
   05022 Pathways of neurodegeneration - multiple diseases
    110563014
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110563014
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110563014
   05135 Yersinia infection
    110563014
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110563014
   05161 Hepatitis B
    110563014
   05163 Human cytomegalovirus infection
    110563014
   05167 Kaposi sarcoma-associated herpesvirus infection
    110563014
   05169 Epstein-Barr virus infection
    110563014
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110563014
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110563014
Protein kinases [BR:mun01001]
 Serine/threonine kinases: STE group
  STE7 family
   110563014
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 110563014
NCBI-ProteinID: XP_021515627
LinkDB
Position
Unknown
AA seq 334 aa
MSFPIGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAELVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtccttccccataggcaagaagcgaaaccctggccttaagattccaaaagaagcgttt
gaacagcctcagaccagctccacgccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcccatagtggagctggga
cgaggtgcgtacggggtggtggagaagatgcggcatgtacccagcgggcagatcatggca
gtgaagaggatccgggccacggtaaatagtcaggagcagaaacggctactgatggatctg
gatgtttccatgaggacagtggactgtccgtttaccgtcaccttctacggtgcgctcttc
cgggagggtgatgtgtggatctgcatggagctcatggatacgtcactagataaattctac
aaacaagtcattgataaaggccaaacaattccagaggatatcttagggaagatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctctctgttatccatcgagatgtc
aaaccttctaatgtgctcatcaacacgctgggtcaagtgaagatgtgtgattttggaatc
agcggctacttggtggactccgttgccaaaacaattgacgcaggttgcaaaccatacatg
gctcctgaacgaataaacccggagctcaatcagaagggctacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagctggccatccttcggtttccctacgactcttgg
ggaacccccttccagcagctaaagcaggtggtagaagagccatccccccagctccccgca
gacaagttctccgcagagttggttgactttacctcacagtgcttgaagaaaaattccaaa
gaacggcccacgtatccagagcttatgcaacatccatttttcaccctacatgaatccaaa
gcaacagacgtggcatcttttgtaaaactgatacttggggactaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563015
Entry
110563015         CDS       T05884                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04218  Cellular senescence
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110563015
   04015 Rap1 signaling pathway
    110563015
   04668 TNF signaling pathway
    110563015
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110563015
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110563015
   04664 Fc epsilon RI signaling pathway
    110563015
  09152 Endocrine system
   04912 GnRH signaling pathway
    110563015
   04935 Growth hormone synthesis, secretion and action
    110563015
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110563015
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110563015
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110563015
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110563015
   05022 Pathways of neurodegeneration - multiple diseases
    110563015
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110563015
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110563015
   05135 Yersinia infection
    110563015
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110563015
   05161 Hepatitis B
    110563015
   05163 Human cytomegalovirus infection
    110563015
   05167 Kaposi sarcoma-associated herpesvirus infection
    110563015
   05169 Epstein-Barr virus infection
    110563015
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110563015
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110563015
Protein kinases [BR:mun01001]
 Serine/threonine kinases: STE group
  STE7 family
   110563015
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 110563015
NCBI-ProteinID: XP_021515628
LinkDB
Position
Unknown
AA seq 328 aa
KKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGV
VEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVW
ICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVL
INTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGIT
MIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAELVDFTSQCLKKNSKERPTYP
ELMQHPFFTLHESKATDVASFVKLILGD
NT seq 989 nt   +upstreamnt  +downstreamnt
gcaagaagcgaaaccctggccttaagattccaaaagaagcgtttgaacagcctcagacca
gctccacgccacctcgagatttagactccaaggcttgcatttctattggaaatcagaact
ttgaggtgaaggcagatgacctggagcccatagtggagctgggacgaggtgcgtacgggg
tggtggagaagatgcggcatgtacccagcgggcagatcatggcagtgaagaggatccggg
ccacggtaaatagtcaggagcagaaacggctactgatggatctggatgtttccatgagga
cagtggactgtccgtttaccgtcaccttctacggtgcgctcttccgggagggtgatgtgt
ggatctgcatggagctcatggatacgtcactagataaattctacaaacaagtcattgata
aaggccaaacaattccagaggatatcttagggaagatagcagtttctattgtaaaagcat
tagaacatttacacagtaagctctctgttatccatcgagatgtcaaaccttctaatgtgc
tcatcaacacgctgggtcaagtgaagatgtgtgattttggaatcagcggctacttggtgg
actccgttgccaaaacaattgacgcaggttgcaaaccatacatggctcctgaacgaataa
acccggagctcaatcagaagggctacagtgtgaagtctgacatttggagtctgggcatca
caatgattgagctggccatccttcggtttccctacgactcttggggaacccccttccagc
agctaaagcaggtggtagaagagccatccccccagctccccgcagacaagttctccgcag
agttggttgactttacctcacagtgcttgaagaaaaattccaaagaacggcccacgtatc
cagagcttatgcaacatccatttttcaccctacatgaatccaaagcaacagacgtggcat
cttttgtaaaactgatacttggggactaa

DBGET integrated database retrieval system