KEGG   Meriones unguiculatus (Mongolian gerbil): 110561719
Entry
110561719         CDS       T05884                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04630  JAK-STAT signaling pathway
mun04640  Hematopoietic cell lineage
mun04664  Fc epsilon RI signaling pathway
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05221  Acute myeloid leukemia
mun05310  Asthma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110561719
   04151 PI3K-Akt signaling pathway
    110561719
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561719
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110561719
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110561719
   04664 Fc epsilon RI signaling pathway
    110561719
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561719
   05202 Transcriptional misregulation in cancer
    110561719
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110561719
  09163 Immune disease
   05310 Asthma
    110561719
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110561719
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110561719
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110561719
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Cytokines
   110561719
SSDB
Motif
Pfam: IL3 T3SS_HrpK1
Other DBs
NCBI-GeneID: 110561719
NCBI-ProteinID: XP_021513918
LinkDB
Position
Unknown
AA seq 150 aa
MVLASSTTRVLSTLLLLLMLLHQGLQASVRSSTTYHSSSGTTSALNCKFIAKEIRGRLSD
KTLQRANLHEFLKKQQELDPKDDIGIKSNLQKLECCLPAAEGTSEKSGIFIGNLTDFKQK
LKFFVSNLEPLSNPRPSHSTSSPTTECENS
NT seq 453 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccacccgtgtcctctccacgctgctcctgctcctgatgctg
ctccaccaaggactccaagcttcagtcaggagctcaactacctaccactcatcctcaggc
acaaccagcgcattgaattgcaaatttattgccaaggagatcagaggaaggctttcagat
aagaccttgcagagagcaaacctgcatgaattcctgaaaaagcaacaggagctggatcct
aaggacgacattggtatcaaaagcaatcttcagaagcttgagtgttgcctgcctgcagct
gagggtacttctgagaagtcaggcatcttcattggcaatctgactgactttaagcagaaa
ctgaagttctttgtgagcaatctggagccactatcaaaccctagaccatctcattcaaca
tcttcacccaccacggagtgtgaaaacagctga

DBGET integrated database retrieval system