KEGG   Meriones unguiculatus (Mongolian gerbil): 110561796
Entry
110561796         CDS       T05884                                 

Gene name
Cd40lg
Definition
(RefSeq) CD40 ligand isoform X1
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04064  NF-kappa B signaling pathway
mun04514  Cell adhesion molecules
mun04660  T cell receptor signaling pathway
mun04672  Intestinal immune network for IgA production
mun05144  Malaria
mun05145  Toxoplasmosis
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05322  Systemic lupus erythematosus
mun05330  Allograft rejection
mun05340  Primary immunodeficiency
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110561796 (Cd40lg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561796 (Cd40lg)
   04514 Cell adhesion molecules
    110561796 (Cd40lg)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110561796 (Cd40lg)
   04672 Intestinal immune network for IgA production
    110561796 (Cd40lg)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110561796 (Cd40lg)
   05322 Systemic lupus erythematosus
    110561796 (Cd40lg)
   05320 Autoimmune thyroid disease
    110561796 (Cd40lg)
   05330 Allograft rejection
    110561796 (Cd40lg)
   05340 Primary immunodeficiency
    110561796 (Cd40lg)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110561796 (Cd40lg)
  09174 Infectious disease: parasitic
   05144 Malaria
    110561796 (Cd40lg)
   05145 Toxoplasmosis
    110561796 (Cd40lg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110561796 (Cd40lg)
   04090 CD molecules [BR:mun04090]
    110561796 (Cd40lg)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Tumor necrosis fators
   110561796 (Cd40lg)
CD molecules [BR:mun04090]
 Proteins
  110561796 (Cd40lg)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 110561796
NCBI-ProteinID: XP_021513991
LinkDB
Position
Unknown
AA seq 260 aa
MIETYSQTSPRSVPTGLPSSMKIFMYLLTVFLITQMIGSALYAVYLHRRLDKVEEEISLH
EDFVFIKMLQRCQKGEGPLSLLNCEGKRKQFEDLFKSIMLNKGEKKENSFEMQKGDEDPQ
IAAHVVSEANNKTASALQWAKKGYYTMKSNLVTLENGNQLTVKRQGPYYVYTQVTFCSNR
EPSSQGPFIVNLWLKHSGGSERILLRAANTHSSSKPCEQQSVHLGGVFELQAGASVFVNV
TDASQVIHRVGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatagaaacatacagccaaacttctccccgatcggtgcctactggacttcccagcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcggcg
ctttatgctgtgtatcttcatagaagattggataaggtcgaagaggaaataagccttcat
gaagattttgtattcataaagatgctacagagatgccaaaaaggagaagggcccttgtcc
ttgctgaactgtgagggaaagagaaagcaatttgaagaccttttcaagagtataatgtta
aacaaaggagagaaaaaagaaaacagctttgaaatgcaaaaaggtgatgaggatcctcaa
attgcagcacatgttgtaagcgaggccaacaataaaacagcatctgctctacagtgggcc
aagaaaggatattacaccatgaaaagcaacttggtaactcttgaaaatgggaaccagctg
accgttaaaagacaaggaccctattatgtctacacccaggtgaccttctgttctaatcgg
gaaccttcgagtcaaggtccatttatagtcaacctctggctgaagcacagtggtggatct
gagagaatcttactcagggcggcaaatacccacagttcctccaagccttgcgagcaacag
tccgttcacttgggaggagtctttgaattacaagcgggtgcctctgtgtttgtcaatgtg
actgatgcaagccaagtgatccacagagtcggcttcacatcttttggcttactcaaactc
tga

DBGET integrated database retrieval system