KEGG   Meriones unguiculatus (Mongolian gerbil): 110561827
Entry
110561827         CDS       T05884                                 

Gene name
Ifng
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03050  Proteasome
mun04060  Cytokine-cytokine receptor interaction
mun04066  HIF-1 signaling pathway
mun04217  Necroptosis
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04612  Antigen processing and presentation
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05200  Pathways in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    110561827 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110561827 (Ifng)
   04630 JAK-STAT signaling pathway
    110561827 (Ifng)
   04066 HIF-1 signaling pathway
    110561827 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561827 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110561827 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110561827 (Ifng)
   04612 Antigen processing and presentation
    110561827 (Ifng)
   04660 T cell receptor signaling pathway
    110561827 (Ifng)
   04658 Th1 and Th2 cell differentiation
    110561827 (Ifng)
   04659 Th17 cell differentiation
    110561827 (Ifng)
   04657 IL-17 signaling pathway
    110561827 (Ifng)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110561827 (Ifng)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561827 (Ifng)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110561827 (Ifng)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110561827 (Ifng)
   05323 Rheumatoid arthritis
    110561827 (Ifng)
   05321 Inflammatory bowel disease
    110561827 (Ifng)
   05330 Allograft rejection
    110561827 (Ifng)
   05332 Graft-versus-host disease
    110561827 (Ifng)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110561827 (Ifng)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110561827 (Ifng)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110561827 (Ifng)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110561827 (Ifng)
   05164 Influenza A
    110561827 (Ifng)
   05168 Herpes simplex virus 1 infection
    110561827 (Ifng)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110561827 (Ifng)
   05144 Malaria
    110561827 (Ifng)
   05145 Toxoplasmosis
    110561827 (Ifng)
   05140 Leishmaniasis
    110561827 (Ifng)
   05142 Chagas disease
    110561827 (Ifng)
   05143 African trypanosomiasis
    110561827 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mun03051]
    110561827 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110561827 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110561827 (Ifng)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110561827 (Ifng)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110561827 (Ifng)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Cytokines
   110561827 (Ifng)
SSDB
Motif
Pfam: IFN-gamma DUF3336
Other DBs
NCBI-GeneID: 110561827
NCBI-ProteinID: XP_021514060
LinkDB
Position
Unknown
AA seq 173 aa
MNATHCILALQLCLLAISGCSSQVPIIEEIENLKRYFNSSNSAVGDSKDVVLHVLRNWQE
DGDTKVIDVQIVSFYFKLFEALKGNQAIEKSINAIRADLIANFFNNSEAKYDGFMSIMKI
EVNDPQIQSKAINELVKVMGHLSPRVTLRKRKRSRCCFGGGNRLNKNNPASTI
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaacgctacacactgcatcttggctttgcagctctgcctcctggcgatttctggctgc
agtagtcaggtcccaatcattgaagaaatagaaaatctgaagagatatttcaactcaagt
aactcagctgtgggggatagtaaggacgttgttttacatgtcttgaggaactggcaagag
gatggcgacacaaaagtaattgatgtccagattgtctctttctacttcaaactctttgaa
gccttgaaaggcaaccaagccattgagaagagcataaacgccatcagggcagatctaatc
gctaacttctttaacaacagtgaagcgaaatacgatgggttcatgagcatcatgaagatt
gaggtaaatgatccacagatccagagcaaagctatcaatgaacttgtcaaagtaatgggc
catctgtcacccagagtcaccctaaggaagcggaaaaggagtcggtgctgcttcggaggt
ggcaatcgtctaaataagaacaatcctgccagcactatttga

DBGET integrated database retrieval system