KEGG   Meriones unguiculatus (Mongolian gerbil): 110562230
Entry
110562230         CDS       T05884                                 

Gene name
Kif7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110562230 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110562230 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110562230 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mun04812]
    110562230 (Kif7)
Cytoskeleton proteins [BR:mun04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110562230 (Kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110562230
NCBI-ProteinID: XP_021514610
LinkDB
Position
Unknown
AA seq 1353 aa
MGLEAQRLPEAEEAPVRVALRVRPLLPKELLHGHQSCLQAEPEHGRITLGRDRRFGFHVV
LGEDTGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRAPSRLPRPAA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWKPE
AERAPDEQGAGARGPPRHRSETRIIHRGRRPPCPAVGSAAAAAGLGAECARCRARTSAAY
SLLRELQAEPGLPGAAVRKVRDWLCAVEGERSALSSASGPDSGIESAPAEDQAAQGTSGR
KGDEGAQQLSLLQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
ARPGWGAPALWQGLPPGSFVPRPHTAPLGGAHPHGMGVVPPACLPGEEVGSEQVANGREV
KAEVSAQVDKLGSGSSTTSEEEGEEEDDEEEEPPRRTLYLRRNGISNWSQRAGVRPGSPT
DRKGPEVCLEEPAAAIPAPQVGGGKVPVQTRQNPAAMASEWRLAQAQQKIRELAINIRMK
EELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELCEGQRQLRELEGREPQDANER
SRLQEFRKRVAAAQSQVQVLKEKKQATERLVSLSAQSETRLQELERNVRLMRRQQGQLQR
RLREETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGSNGSVV
SLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELHKREVILAKKEALMQEKTGLESKR
LRSSQVSPHHKIPGKALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQNQQQIRGEIDTL
RQEKDSLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVL
RASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEE
QQRLVYWLEVALERQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARI
QALEKELGRHMWINQELKQKLSGGNTVGQSRGGERRSLCLENRQGLGNEDGLHPAASEPL
WQSSLLEGAPRAWDEARDLVHAPLPLTWKRSSLCSEQGSSEELRARETTEPPVGRVLPVG
EAGLSWNFGPLPKPRWEPRRTSPGMIDVRKNPL
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggggctggaggcccaaaggctgcctgaggctgaggaagctccggtgagggtggccctc
cgagtccgcccattactgcccaaggagctgctgcacggccatcagagctgcctgcaggcg
gagcccgagcatggccgaatcaccctggggcgggaccgccgctttggattccatgtggtt
ctgggagaggacactggacaagaggctgtgtaccaggcttgcgtccagccccttctcgag
gccttctttgagggcttcaatgccaccgtctttgcctatggtcagacaggctcggggaag
acgtataccatgggggaggccagtgtggcctccctgcatgaagatgaacagggcatcatc
ccaagggccatggccgaggccttcaagctcattgatgagaatgacctgctggactgtctg
gtgcatgtgtcctacctggaggtgtacaaggaagagttccgagatctgctagaagtgggc
actgccagccgggacatccagcttcgggaagacgagcggggaaatgtcgtgctgtgtggg
gtgaaagaagtggacgtggaaggcctggatgaggtgctgagcctcctggagatgggcaac
gctgcgcggcacacaggcgccacacacttcaaccgcctctccagccgctcacacacggtc
ttcacagtgactctggagcagcgagggcgggctcctagccgcctacctcgacctgccgcg
ggacacctgctggtctccaaattccacttcgtggaccttgcaggctccgagagggttctc
aagaccggcagcaccggcgaaaggctcaaagagagcatccagattaacagcaccctgctg
gcgctgggcaatgtcatcagcgctctgggggatccccagcgccgcggcagccacatcccc
taccgcgactccaagattacccggatcctcaaagactccctgggagggaatgccaagacg
gtgatgatcgcctgcgtcagcccctcctcctccgacttcgacgagaccctcaacaccctc
aactacgccagccgtgcccagaacatccgcaatcgcgccacagtcaactggaagccggag
gccgagcgcgcccccgacgaacaaggggcaggcgcgcgcgggccgccgcgacaccgctcg
gagacgcgcatcatccaccgcggccggcgccctccctgccccgccgtgggctcggccgca
gccgcggcgggcctgggcgccgagtgcgcgcgctgccgggctcgcaccagcgccgcctac
agcctcctgcgagagttgcaggccgagccagggctgccgggcgctgctgtccgcaaggtg
cgggactggctgtgcgcggtggagggcgagcgcagcgcgctgagctccgcctccgggccc
gacagcggcattgagagcgccccagcggaggaccaggcggcacaagggaccagcgggaga
aagggagatgaaggggcccagcagctgtcgctcctgcagagccaggtggcccggctagag
gaggagaatcgcgactttctggcggcgttggaggacgccatggagcagtacaagctacag
agtgaccgcctgcgggagcagcaggaggagatggtggagcttcggctgcggctagagctg
gcgcgtcctggctggggagcaccggcactatggcagggcttgcctcccggctcctttgtg
cctcggcctcacacagcccccctgggaggtgcacatcctcatgggatgggcgtggtgccc
cctgcttgtcttcctggagaagaagttggttctgagcaggtggcaaatggcagggaagtc
aaggcggaggtgtcggcccaggtggacaagctgggaagtggctcttccactacatccgaa
gaggaaggggaggaggaggacgacgaagaagaggagccacccaggcggaccttgtacctg
cgcagaaatgggatcagcaactggagccagagagcaggcgtgcgtccagggagcccaact
gacaggaagggcccagaggtctgcctagaagagccagctgctgccatcccagcaccccaa
gttggtggtggcaaggtcccagttcagacccgccagaacccagctgccatggcctctgag
tggcgactggcccaggctcagcagaagatccgtgaactggccatcaacatccgaatgaag
gaggagctcattggtgagctggtccgcacagggaaggccgcccaagccctaaaccgccag
catagccaacgcatcagggagctggagcaagaggcggagcgtgtgcgggcggagctgtgt
gaagggcagagacagctccgggagctggagggcagggagccccaggatgccaacgagagg
tccaggcttcaggaattccgcaagagagtggctgcagcccagagccaggtgcaggtgctg
aaggagaagaagcaggcaacagagcggctggtgtcactgtcggctcaaagtgagactcgg
ctgcaggagctggagaggaatgtgcggctcatgcgacgacagcaggggcagctgcagagg
cggctccgggaggagacagagcagaagcggcgcctagagacagagatgaacaagcggcag
catcgtgtcaaggagctggagctgaagcatgagcaacagcaaaagatcctgaaaatcaag
actgaggagattgcagccttccagaggaagaggcgcagcggcagcaatggctccgtggtc
agcctggagcagcagcagaagattgaggagcagaagaagtggctggaccaggagatggaa
aaggtgctgcagcagcggcgggcgctggaggagctgggagaggagctccacaagcgggaa
gtcatcctggccaagaaggaggccctgatgcaggagaagacggggctagagagcaagcgc
ctgaggtccagccaggtgagcccccaccacaagattcctggcaaggccctaaatgaggac
atcgtgcgcgtgtccagccgtctagaacacctggagaaggagctgtctgagaagagtggg
cagcttcggcaaggcagtgcccagaaccagcagcagatccgaggggagatagacaccctg
cgccaggagaaggactccctgctgaagcagcgcctggagattgatagcaagctgaggcag
ggaagcctgctgtcccctgaggaggagaggacccttttccagctagatgaagccatcgag
gccctggatgctgccattgagtacaagaacgaggctatcacatgtcgccagcgggtgctg
cgggcttcggcctccctgctgtcacagtgtgagatgaatctcatggccaaactcagctac
ctctcctcctcagagaccagagccctgctgtgcaagtattttgacaaggtggtaacactc
cgagaggaacaacaccagcaacagatcgcgttctcggaactggagatgcagctggaggag
cagcagcggctggtgtattggctggaggtagcactggagcggcagcgcctggagatggac
cgccaactaaccctgcagcagaaggagcacgagcagaacgtgcagctactccttcagcag
ggtcgagaccaccttggtgaggggttagcagacagcaagaggcaatatgaggctcggatt
caagctctggagaaggaactgggccgacacatgtggataaaccaggagctgaaacagaag
ctcagtggaggaaacactgtgggccagagccggggtggtgagaggagaagcctctgcttg
gaaaaccgacaaggccttggaaatgaagatgggctccacccagcagcttctgaacctctc
tggcagtcctcccttctggagggagcaccccgggcctgggatgaggcccgggacttggtc
catgccccactacccctaacatggaaacgttcaagcctgtgcagtgagcagggctcctct
gaggagctgagggcccgggaaacaactgaacccccagtagggcgggtgttaccagtgggt
gaagctggcctctcctggaactttggacctttgcctaagcccaggtgggaaccccgaaga
accagcccagggatgattgatgtcaggaaaaaccctttgtag

DBGET integrated database retrieval system