KEGG   Meriones unguiculatus (Mongolian gerbil): 110562241
Entry
110562241         CDS       T05884                                 

Gene name
Mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04115  p53 signaling pathway
mun04120  Ubiquitin mediated proteolysis
mun04144  Endocytosis
mun04151  PI3K-Akt signaling pathway
mun04218  Cellular senescence
mun04625  C-type lectin receptor signaling pathway
mun04919  Thyroid hormone signaling pathway
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110562241 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110562241 (Mdm2)
   04151 PI3K-Akt signaling pathway
    110562241 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110562241 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    110562241 (Mdm2)
   04115 p53 signaling pathway
    110562241 (Mdm2)
   04218 Cellular senescence
    110562241 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110562241 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110562241 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110562241 (Mdm2)
   05202 Transcriptional misregulation in cancer
    110562241 (Mdm2)
   05206 MicroRNAs in cancer
    110562241 (Mdm2)
   05205 Proteoglycans in cancer
    110562241 (Mdm2)
   05203 Viral carcinogenesis
    110562241 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    110562241 (Mdm2)
   05220 Chronic myeloid leukemia
    110562241 (Mdm2)
   05218 Melanoma
    110562241 (Mdm2)
   05219 Bladder cancer
    110562241 (Mdm2)
   05215 Prostate cancer
    110562241 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110562241 (Mdm2)
   05169 Epstein-Barr virus infection
    110562241 (Mdm2)
   05165 Human papillomavirus infection
    110562241 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110562241 (Mdm2)
   01522 Endocrine resistance
    110562241 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110562241 (Mdm2)
   04121 Ubiquitin system [BR:mun04121]
    110562241 (Mdm2)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110562241 (Mdm2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110562241 (Mdm2)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    110562241 (Mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB DUF4194 zf-RING_2 zf-FPG_IleRS Fer4_15
Other DBs
NCBI-GeneID: 110562241
NCBI-ProteinID: XP_021514623
LinkDB
Position
Unknown
AA seq 437 aa
MKEIIFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV
VGQQESSDSGTSMSESRYQPEGGSDLKDPVQDPQEEKPSSSDSVSRPTTSSRRRAISETE
ENAADLPGDRQRKRHRSLSFDESLALCVLRGMCCERSSSSESTETPEHQDLDDGVSEHSG
DWLDQDAVSDQFSVEFEVESLDSEDYSLSEEGHELSDEDDEVYRVTVYQAGESDADSFEG
DPEISLADYWKCTSCNEMNPPLPPHCNRCWTLRENWLPEDKGKDKGEDSEKAKLENSAQA
EEALDVPDGRKSTVNESKDSCPEESDDKVTWASQSQESEDYSQPSTSSSIVYSPQEDVKE
LKERTQVKEESMESSFSLSAVEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaaagagattatattttatcttggccagtatattatgactaaaagattatatgatgag
aagcagcagcatattgtgtattgttcaaacgatcttctaggagatttgtttggagtgcca
agtttctctgtgaaagagcacaggaaaatatatacaatgatctacagaaacttggtggtc
gtaggtcagcaagaatcttcagactctggcacgtcgatgagtgagagcagataccagcct
gaaggtgggagtgatctgaaggaccctgttcaagatccacaagaagagaagccttcatct
tctgattcagtttctagaccaactacctcatctagaaggagagcaattagcgagacagaa
gaaaatgcagctgacctgcctggtgaccgacagaggaagcgccacagatccctttctttt
gatgagagcctggccctgtgtgtgctgagagggatgtgctgtgaaagaagcagcagcagt
gaatccacagagaccccagagcatcaggatcttgatgatggtgtaagtgaacattccggt
gattggttggatcaggatgcagtttctgatcagtttagtgtagaatttgaagttgagtct
ctcgattcagaagactacagcctgagtgaagaagggcatgagctctcggatgaggatgat
gaggtctatcgagtcacagtgtatcaggctggagaaagtgatgcagactcctttgaggga
gatcctgaaatttccttagctgactattggaaatgtacctcttgcaatgaaatgaatcct
ccacttccaccacactgcaacagatgttggacccttcgtgagaattggcttccagaagat
aaagggaaagataaaggggaagactctgaaaaagccaaactggaaaactcagctcaggca
gaagaagccttagatgtgccagatggcaggaaaagtacagtgaatgagtctaaagattcg
tgccctgaggaaagcgatgataaagtcacgtgggcctcccagtcacaagagagtgaggac
tattcccagccatcaacttccagtagcattgtttatagcccccaagaagatgtcaaagag
ttgaaggaaagaacacaagtcaaagaagaaagtatggaatctagcttctctctcagtgcc
gttgaaccgtgtgtgatttgccaagggcggcctaaaaatggctgtattgttcatggcaaa
actggacatctcatgtcatgtttcacatgtgcaaagaagcttaaaaaaaggaataagccc
tgcccagtatgcagacagccaattcagatgattgtcctaacttacttcagctag

DBGET integrated database retrieval system