KEGG   Meriones unguiculatus (Mongolian gerbil): 110562528
Entry
110562528         CDS       T05884                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01523  Antifolate resistance
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04062  Chemokine signaling pathway
mun04064  NF-kappa B signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04668  TNF signaling pathway
mun04920  Adipocytokine signaling pathway
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05212  Pancreatic cancer
mun05215  Prostate cancer
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05340  Primary immunodeficiency
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110562528 (Ikbkg)
   04014 Ras signaling pathway
    110562528 (Ikbkg)
   04064 NF-kappa B signaling pathway
    110562528 (Ikbkg)
   04668 TNF signaling pathway
    110562528 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    110562528 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110562528 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110562528 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    110562528 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    110562528 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    110562528 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    110562528 (Ikbkg)
   04660 T cell receptor signaling pathway
    110562528 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    110562528 (Ikbkg)
   04659 Th17 cell differentiation
    110562528 (Ikbkg)
   04657 IL-17 signaling pathway
    110562528 (Ikbkg)
   04662 B cell receptor signaling pathway
    110562528 (Ikbkg)
   04062 Chemokine signaling pathway
    110562528 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110562528 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110562528 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110562528 (Ikbkg)
   05203 Viral carcinogenesis
    110562528 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110562528 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110562528 (Ikbkg)
   05221 Acute myeloid leukemia
    110562528 (Ikbkg)
   05220 Chronic myeloid leukemia
    110562528 (Ikbkg)
   05215 Prostate cancer
    110562528 (Ikbkg)
   05222 Small cell lung cancer
    110562528 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    110562528 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110562528 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110562528 (Ikbkg)
   05135 Yersinia infection
    110562528 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110562528 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    110562528 (Ikbkg)
   05162 Measles
    110562528 (Ikbkg)
   05164 Influenza A
    110562528 (Ikbkg)
   05161 Hepatitis B
    110562528 (Ikbkg)
   05160 Hepatitis C
    110562528 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    110562528 (Ikbkg)
   05163 Human cytomegalovirus infection
    110562528 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110562528 (Ikbkg)
   05169 Epstein-Barr virus infection
    110562528 (Ikbkg)
   05165 Human papillomavirus infection
    110562528 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110562528 (Ikbkg)
   05142 Chagas disease
    110562528 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110562528 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110562528 (Ikbkg)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110562528 (Ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ERM
Other DBs
NCBI-GeneID: 110562528
NCBI-ProteinID: XP_021514947
LinkDB
Position
Unknown
AA seq 412 aa
MSRHLWKNQLSEMVQPSGGPAGDQDMPGEESSLGKPTMLHLPSEQGTSETLQRCLEENQE
LRDAIRQSNQMLRERCEELLQFQVSQREEKEFLMGKFQEARKLVERLSLEKLDLRRQREQ
ALKDMEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEQQTLEERMRAVSEQ
VRQLESEREALQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD
YDSHIKSSKGVQLEDLRRQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADI
YKADFQAERHAREKLVEKKELLQEQLEQLQREFNKLKVGCHESARIEDMRKRHVETSQPP
LLPAQAHHSFHSPLSNQRRIPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcacctgtggaagaatcagctgagtgagatggtgcagcccagtggtggccca
gcaggggatcaggacatgccgggtgaagaatcttccctagggaagccaacaatgctacat
ctgccttcagagcagggtacttctgagaccctccagcgctgtctggaagagaatcaagag
ctccgagatgctatccgacagagcaatcaaatgctaagggaacgctgtgaggagctgcta
cagtttcaggtcagccagcgggaggagaaggaattccttatgggcaaattccaggaagcc
aggaagctggtggaaagactgagcttggagaagcttgaccttcggcggcagagggaacag
gccttaaaggatatggagcacctgaagaaatgccagcagcagatggctgaggacaaggcc
tccgtgaaagcccaggtgacatcactgctgggagaactccaggagagccagagtcgtttg
gaggctgccacaaaggaacaacaaactttagaggaaaggatgcgagctgttagtgagcag
gtcagacagctggagagtgagcgggaagccctgcagcagcagcatagtgtgcaggtggac
cagctgcgcatgcagaaccagagtgtggaggctgcccttcggatggagcgacaggctgcc
tcagaggaaaagcggaagctggctcagttgcaggcagcctatcaccagctcttccaagac
tatgatagccacattaagagcagcaagggcgtgcagctggaagatctgaggcgacagctc
cagcaagccgaagaggccctggtagcaaaacaggaattgattgataagctgaaagaggag
gctgagcagcacaagattgtgatggagactgtaccagtcctgaaggcccaggcggatatc
tacaaggctgacttccaagccgagagacatgctcgggagaagctggtggagaagaaggaa
cttctgcaggagcagctagagcagctacagcgtgaattcaacaagctgaaagttggctgc
catgagtcagccaggattgaggatatgaggaagcgacatgtagagacttcccagccccct
ttactccctgctcaggctcaccactcctttcattcgcccttgtccaaccagcggaggatc
cctcctgaggaaccacctgacttttgttgtcccaagtgccagtatcaggctcctgatatg
gacactctgcagatacacgtcatggagtgcatagagtag

DBGET integrated database retrieval system